KEGG   Homo sapiens (human): 51545
Entry
51545             CDS       T01001                                 
Symbol
ZNF581, HSPC189
Name
(RefSeq) zinc finger protein 581
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_jaz zf-met BolA zf-Di19 DUF5810 zf-C2HC_2 zf-C2H2_6 zf-C2H2_8
Other DBs
NCBI-GeneID: 51545
NCBI-ProteinID: NP_057619
HGNC: 25017
Ensembl: ENSG00000171425
UniProt: Q9P0T4
Position
19:55635003..55645623
AA seq 197 aa
MLVLPSPCPQPLAFSSVETMEGPPRRTCRSPEPGPSSSIGSPQASSPPRPNHYLLIDTQG
VPYTVLVDEESQREPGASGAPGQKKCYSCPVCSRVFEYMSYLQRHSITHSEVKPFECDIC
GKAFKRASHLARHHSIHLAGGGRPHGCPLCPRRFRDAGELAQHSRVHSGERPFQCPHCPR
RFMEQNTLQKHTRWKHP
NT seq 594 nt   +upstreamnt  +downstreamnt
atgctggtgctgccatccccctgccctcagcctctggcattttcctccgttgagaccatg
gagggccctccccgtcggacttgccgctccccagaacctggaccttcctcctccatcgga
tctccccaggcttcatctcctccaaggcccaaccactacctgcttattgacactcagggt
gtcccctacacagtgctggtggacgaggagtcacagagggagccaggggccagtggggct
ccaggccagaaaaagtgctacagctgccccgtgtgctcaagggtcttcgagtacatgtcc
taccttcagcgacacagcatcacccactcggaggtaaagcccttcgagtgtgacatctgt
gggaaggcattcaagcgcgccagccacttggcacggcaccattccattcacctggcgggt
ggtgggcggccccacggctgcccgctctgccctcgccgcttccgggatgcgggtgagctg
gcccagcacagccgggtgcactctggggaacgcccgtttcagtgtccacactgccctcgc
cgctttatggagcagaacacactgcagaaacacacgcggtggaagcatccatga

DBGET integrated database retrieval system