KEGG   Homo sapiens (human): 51611
Entry
51611             CDS       T01001                                 

Gene name
DPH5, AD-018, CGI-30, HSPC143, NPD015
Definition
(RefSeq) diphthamide biosynthesis 5
  KO
K00586  diphthine methyl ester synthase [EC:2.1.1.314]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hsa03012]
    51611 (DPH5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.314  diphthine methyl ester synthase
     51611 (DPH5)
Translation factors [BR:hsa03012]
 Eukaryotic type
  Elongation factors
   Elongation associated factors
    51611 (DPH5)
SSDB
Motif
Pfam: TP_methylase GatB_N
Other DBs
NCBI-GeneID: 51611
NCBI-ProteinID: NP_001070862
OMIM: 611075
HGNC: 24270
Ensembl: ENSG00000117543
Vega: OTTHUMG00000010829
Pharos: Q9H2P9(Tdark)
UniProt: Q9H2P9 B3KWP1
Position
1p21.2
AA seq 285 aa
MLYLIGLGLGDAKDITVKGLEVVRRCSRVYLEAYTSVLTVGKEALEEFYGRKLVVADREE
VEQEADNILKDADISDVAFLVVGDPFGATTHSDLVLRATKLGIPYRVIHNASIMNAVGCC
GLQLYKFGETVSIVFWTDTWRPESFFDKVKKNRQNGMHTLCLLDIKVKEQSLENLIKGRK
IYEPPRYMSVNQAAQQLLEIVQNQRIRGEEPAVTEETLCVGLARVGADDQKIAAGTLRQM
CTVDLGEPLHSLIITGGSIHPMEMEMLSLFSIPENSSESQSINGL
NT seq 858 nt   +upstreamnt  +downstreamnt
atgctttatctcatcgggttgggcctgggagatgccaaggacatcacagtcaagggcctg
gaagttgttagacgctgcagtcgagtgtatctggaagcctacacctcagtcctaactgta
gggaaggaagccttggaagagttttatggaagaaaattggttgttgctgatagagaagaa
gtggaacaagaagcagataatattttaaaggatgctgatatcagtgatgttgcattcctt
gtggttggtgatccatttggggccacaacacacagtgatcttgttctaagagcaacaaag
ctgggaattccttatagagttattcacaatgcctccataatgaatgctgtaggctgctgt
ggtttacagttatataagtttggagagacagtttctattgttttttggacagacacttgg
agaccagaaagcttctttgacaaagtgaagaagaacagacaaaatggcatgcacacatta
tgtttactagacatcaaagtaaaggagcagtctttggaaaatctaatcaagggaaggaag
atctatgaacctccacggtatatgagtgtaaaccaagcagcccagcagcttctggagatt
gttcaaaatcaaagaatacgaggagaagaaccagcagttaccgaggagacactttgtgtt
ggcttagccagggttggagccgacgaccagaaaattgcagcaggcactttaaggcaaatg
tgcactgtggacttgggagaaccattgcattccttgatcatcacaggaggcagcatacat
ccaatggagatggagatgctaagtctgttttccataccagaaaatagctcagaatctcaa
agcatcaatggactttga

DBGET integrated database retrieval system