KEGG   Homo sapiens (human): 52
Entry
52                CDS       T01001                                 

Gene name
ACP1, HAAP, LMW-PTP, LMWPTP
Definition
(RefSeq) acid phosphatase 1
  KO
K14394  low molecular weight phosphotyrosine protein phosphatase [EC:3.1.3.2 3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00730  Thiamine metabolism
hsa00740  Riboflavin metabolism
hsa01100  Metabolic pathways
hsa04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    52 (ACP1)
   00740 Riboflavin metabolism
    52 (ACP1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    52 (ACP1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    52 (ACP1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     52 (ACP1)
    3.1.3.48  protein-tyrosine-phosphatase
     52 (ACP1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class II PTPs
   Low molecular weight PTPs (LMWPTPs)
    52 (ACP1)
SSDB
Motif
Pfam: LMWPc
Other DBs
NCBI-GeneID: 52
NCBI-ProteinID: NP_004291
OMIM: 171500
HGNC: 122
Ensembl: ENSG00000143727
Vega: OTTHUMG00000086933
Pharos: P24666(Tchem)
UniProt: P24666 Q59EH3
Structure
PDB: 

Position
2p25.3
AA seq 158 aa
MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRG
QSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSY
DPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
NT seq 477 nt   +upstreamnt  +downstreamnt
atggcggaacaggctaccaagtccgtgctgtttgtgtgtctgggtaacatttgtcgatca
cccattgcagaagcagttttcaggaaacttgtaaccgatcaaaacatctcagagaattgg
agggtagacagcgcggcaacttccgggtatgagatagggaacccccctgactaccgaggg
cagagctgcatgaagaggcacggcattcccatgagccacgttgcccggcagattaccaaa
gaagattttgccacatttgattatatactatgtatggatgaaagcaatctgagagatttg
aatagaaaaagtaatcaagttaaaacctgcaaagctaaaattgaactacttgggagctat
gatccacaaaaacaacttattattgaagatccctattatgggaatgactctgactttgag
acggtgtaccagcagtgtgtcaggtgctgcagagcgttcttggagaaggcccactga

KEGG   Homo sapiens (human): 53
Entry
53                CDS       T01001                                 

Gene name
ACP2, LAP
Definition
(RefSeq) acid phosphatase 2, lysosomal
  KO
K14410  lysosomal acid phosphatase [EC:3.1.3.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00740  Riboflavin metabolism
hsa01100  Metabolic pathways
hsa04142  Lysosome
Disease
H01113  Acid phosphatase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    53 (ACP2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    53 (ACP2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     53 (ACP2)
SSDB
Motif
Pfam: His_Phos_2
Other DBs
NCBI-GeneID: 53
NCBI-ProteinID: NP_001601
OMIM: 171650
HGNC: 123
Ensembl: ENSG00000134575
Vega: OTTHUMG00000166949
Pharos: P11117(Tbio)
UniProt: P11117
Position
11p11.2; 11p12-p11
AA seq 423 aa
MAGKRSGWSRAALLQLLLGVNLVVMPPTRARSLRFVTLLYRHGDRSPVKTYPKDPYQEEE
WPQGFGQLTKEGMLQHWELGQALRQRYHGFLNTSYHRQEVYVRSTDFDRTLMSAEANLAG
LFPPNGMQRFNPNISWQPIPVHTVPITEDRLLKFPLGPCPRYEQLQNETRQTPEYQNESS
RNAQFLDMVANETGLTDLTLETVWNVYDTLFCEQTHGLRLPPWASPQTMQRLSRLKDFSF
RFLFGIYQQAEKARLQGGVLLAQIRKNLTLMATTSQLPKLLVYSAHDTTLVALQMALDVY
NGEQAPYASCHIFELYQEDSGNFSVEMYFRNESDKAPWPLSLPGCPHRCPLQDFLRLTEP
VVPKDWQQECQLASGPADTEVIVALAVCGSILFLLIVLLLTVLFRMQAQPPGYRHVADGE
DHA
NT seq 1272 nt   +upstreamnt  +downstreamnt
atggcgggcaagcggtccggctggagccgggcggctctcctccagctccttctcggcgtg
aacctggtggtgatgccgcccacccgggcccggagtctgcgcttcgttaccttgctgtac
cgccatggagaccgttcaccagtgaagacatatcccaaggacccctatcaggaagaagaa
tggccccaggggtttggtcagttaaccaaggaggggatgctacagcactgggaactgggc
caggccctgcggcagcgctatcacggcttcctaaacacctcttatcaccggcaagaggtt
tatgtgcgaagcacagactttgaccggactctcatgagtgctgaggccaacctggctgga
ctcttccctcccaacgggatgcagcgcttcaacccgaacatctcgtggcagcctattcct
gtgcacactgtgcccatcactgaggacaggctgctgaagttcccgttgggcccatgtccc
cgttatgagcagctgcagaacgagacccggcagacaccagagtatcagaatgagagttct
cggaatgcacaatttctggacatggtggccaacgagacagggcttacagacctgacactg
gagaccgtctggaatgtctatgacacactcttctgtgagcaaacgcacgggctgcgcctg
ccgccctgggcctcaccccaaaccatgcagcgtctcagccggctaaaggacttcagcttc
cgcttcctcttcggaatctaccagcaggcggagaaggcccggcttcaggggggagtcctg
ctggctcagataaggaagaacctgaccctaatggcgaccacctcccagctccccaagctg
ctggtttactctgcgcacgacactaccctggttgccctgcaaatggcactggatgtctac
aatggtgaacaagccccctacgcctcctgccacatatttgaactgtaccaggaagattct
gggaatttctcagtggagatgtactttcggaacgagagtgacaaggccccctggccgctc
agcctgcctggctgccctcaccgctgcccactgcaggacttccttcgcctcacagagccc
gtcgtgcccaaggattggcagcaggagtgccagctggcaagcggtcctgcagacacagag
gtgattgtggccttggctgtatgtggctccatcctcttcctcctcatagtgctgctcctc
accgtcctcttccggatgcaggcccagcctcctggctaccgccacgtcgcagatggggag
gaccacgcctga

KEGG   Homo sapiens (human): 54
Entry
54                CDS       T01001                                 

Gene name
ACP5, HPAP, TRACP5a, TRACP5b, TRAP, TrATPase
Definition
(RefSeq) acid phosphatase 5, tartrate resistant
  KO
K14379  tartrate-resistant acid phosphatase type 5 [EC:3.1.3.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00740  Riboflavin metabolism
hsa01100  Metabolic pathways
hsa04142  Lysosome
hsa04380  Osteoclast differentiation
hsa05323  Rheumatoid arthritis
Disease
H01576  Spondyloenchondrodysplasia with immune dysregulation (SPENCDI)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    54 (ACP5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    54 (ACP5)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    54 (ACP5)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    54 (ACP5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     54 (ACP5)
SSDB
Motif
Pfam: Metallophos Metallophos_2 PhoD
Other DBs
NCBI-GeneID: 54
NCBI-ProteinID: NP_001104504
OMIM: 171640
HGNC: 124
Ensembl: ENSG00000102575
Vega: OTTHUMG00000182036
Pharos: P13686(Tbio)
UniProt: P13686 A0A024R7F8
Structure
PDB: 
2BQ8 1WAR

Position
19p13.2
AA seq 325 aa
MDMWTALLILQALLLPSLADGATPALRFVAVGDWGGVPNAPFHTAREMANAKEIARTVQI
LGADFILSLGDNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQ
IAYSKISKRWNFPSPFYRLHFKIPQTNVSVAIFMLDTVTLCGNSDDFLSQQPERPRDVKL
ARTQLSWLKKQLAAAREDYVLVAGHYPVWSIAEHGPTHCLVKQLRPLLATYGVTAYLCGH
DHNLQYLQDENGVGYVLSGAGNFMDPSKRHQRKVPNGYLRFHYGTEDSLGGFAYVEISSK
EMTVTYIEASGKSLFKTRLPRRARP
NT seq 978 nt   +upstreamnt  +downstreamnt
atggacatgtggacggcgctgctcatcctgcaagccttgttgctaccctccctggctgat
ggtgccacccctgccctgcgctttgtagccgtgggtgactggggaggggtccccaatgcc
ccattccacacggcccgggaaatggccaatgccaaggagatcgctcggactgtgcagatc
ctgggtgcagacttcatcctgtctctaggggacaatttttacttcactggtgtgcaagac
atcaatgacaagaggttccaggagacctttgaggacgtattctctgaccgctcccttcgc
aaagtgccctggtacgtgctagccggaaaccatgaccaccttggcaatgtctctgcccag
attgcatactctaagatctccaagcgctggaacttccccagccctttctaccgcctgcac
ttcaagatcccacagaccaatgtgtctgtggccatttttatgctggacacagtgacacta
tgtggcaactcagatgacttcctcagccagcagcctgagaggccccgagacgtgaagctg
gcccgcacacagctgtcctggctcaagaaacagctggcggcggccagggaggactacgtg
ctggtggctggccactaccccgtgtggtccatagccgagcacgggcctacccactgcctg
gtcaagcagctacggccactgctggccacatacggggtcactgcctacctgtgcggccac
gatcacaatctgcagtacctgcaagatgagaatggcgtgggctacgtgctgagtggggct
gggaatttcatggacccctcaaagcggcaccagcgcaaggtccccaacggctatctgcgc
ttccactatgggactgaagactcactgggtggctttgcctatgtggagatcagctccaaa
gagatgactgtcacttacatcgaggcctcgggcaagtccctctttaagaccaggctgccg
aggcgagccaggccctga

DBGET integrated database retrieval system