KEGG   Homo sapiens (human): 5295Help
Entry
5295              CDS       T01001                                 

Gene name
PIK3R1, AGM7, GRB1, IMD36, p85, p85-ALPHA
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa01522  Endocrine resistance
hsa01524  Platinum drug resistance
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04070  Phosphatidylinositol signaling system
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04140  Autophagy - animal
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04210  Apoptosis
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04218  Cellular senescence
hsa04360  Axon guidance
hsa04370  VEGF signaling pathway
hsa04380  Osteoclast differentiation
hsa04510  Focal adhesion
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04611  Platelet activation
hsa04620  Toll-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04668  TNF signaling pathway
hsa04670  Leukocyte transendothelial migration
hsa04722  Neurotrophin signaling pathway
hsa04725  Cholinergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04810  Regulation of actin cytoskeleton
hsa04910  Insulin signaling pathway
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa04917  Prolactin signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04926  Relaxin signaling pathway
hsa04930  Type II diabetes mellitus
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04960  Aldosterone-regulated sodium reabsorption
hsa04973  Carbohydrate digestion and absorption
hsa05100  Bacterial invasion of epithelial cells
hsa05142  Chagas disease (American trypanosomiasis)
hsa05146  Amoebiasis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05166  HTLV-I infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05205  Proteoglycans in cancer
hsa05210  Colorectal cancer
hsa05211  Renal cell carcinoma
hsa05212  Pancreatic cancer
hsa05213  Endometrial cancer
hsa05214  Glioma
hsa05215  Prostate cancer
hsa05218  Melanoma
hsa05220  Chronic myeloid leukemia
hsa05221  Acute myeloid leukemia
hsa05222  Small cell lung cancer
hsa05223  Non-small cell lung cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
hsa05230  Central carbon metabolism in cancer
hsa05231  Choline metabolism in cancer
hsa05418  Fluid shear stress and atherosclerosis
Module
hsa_M00676  PI3K-Akt signaling
Disease
H01370  SHORT syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5295 (PIK3R1)
   04015 Rap1 signaling pathway
    5295 (PIK3R1)
   04012 ErbB signaling pathway
    5295 (PIK3R1)
   04370 VEGF signaling pathway
    5295 (PIK3R1)
   04630 Jak-STAT signaling pathway
    5295 (PIK3R1)
   04668 TNF signaling pathway
    5295 (PIK3R1)
   04066 HIF-1 signaling pathway
    5295 (PIK3R1)
   04068 FoxO signaling pathway
    5295 (PIK3R1)
   04070 Phosphatidylinositol signaling system
    5295 (PIK3R1)
   04072 Phospholipase D signaling pathway
    5295 (PIK3R1)
   04071 Sphingolipid signaling pathway
    5295 (PIK3R1)
   04024 cAMP signaling pathway
    5295 (PIK3R1)
   04151 PI3K-Akt signaling pathway
    5295 (PIK3R1)
   04152 AMPK signaling pathway
    5295 (PIK3R1)
   04150 mTOR signaling pathway
    5295 (PIK3R1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    5295 (PIK3R1)
  09143 Cell growth and death
   04210 Apoptosis
    5295 (PIK3R1)
   04218 Cellular senescence
    5295 (PIK3R1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    5295 (PIK3R1)
   04550 Signaling pathways regulating pluripotency of stem cells
    5295 (PIK3R1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    5295 (PIK3R1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    5295 (PIK3R1)
   04620 Toll-like receptor signaling pathway
    5295 (PIK3R1)
   04625 C-type lectin receptor signaling pathway
    5295 (PIK3R1)
   04650 Natural killer cell mediated cytotoxicity
    5295 (PIK3R1)
   04660 T cell receptor signaling pathway
    5295 (PIK3R1)
   04662 B cell receptor signaling pathway
    5295 (PIK3R1)
   04664 Fc epsilon RI signaling pathway
    5295 (PIK3R1)
   04666 Fc gamma R-mediated phagocytosis
    5295 (PIK3R1)
   04670 Leukocyte transendothelial migration
    5295 (PIK3R1)
   04062 Chemokine signaling pathway
    5295 (PIK3R1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    5295 (PIK3R1)
   04923 Regulation of lipolysis in adipocyte
    5295 (PIK3R1)
   04915 Estrogen signaling pathway
    5295 (PIK3R1)
   04914 Progesterone-mediated oocyte maturation
    5295 (PIK3R1)
   04917 Prolactin signaling pathway
    5295 (PIK3R1)
   04926 Relaxin signaling pathway
    5295 (PIK3R1)
   04919 Thyroid hormone signaling pathway
    5295 (PIK3R1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    5295 (PIK3R1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    5295 (PIK3R1)
  09156 Nervous system
   04725 Cholinergic synapse
    5295 (PIK3R1)
   04722 Neurotrophin signaling pathway
    5295 (PIK3R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5295 (PIK3R1)
  09158 Development
   04360 Axon guidance
    5295 (PIK3R1)
   04380 Osteoclast differentiation
    5295 (PIK3R1)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    5295 (PIK3R1)
   04213 Longevity regulating pathway - multiple species
    5295 (PIK3R1)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    5295 (PIK3R1)
   05230 Central carbon metabolism in cancer
    5295 (PIK3R1)
   05231 Choline metabolism in cancer
    5295 (PIK3R1)
   05205 Proteoglycans in cancer
    5295 (PIK3R1)
   05203 Viral carcinogenesis
    5295 (PIK3R1)
   05210 Colorectal cancer
    5295 (PIK3R1)
   05212 Pancreatic cancer
    5295 (PIK3R1)
   05225 Hepatocellular carcinoma
    5295 (PIK3R1)
   05226 Gastric cancer
    5295 (PIK3R1)
   05214 Glioma
    5295 (PIK3R1)
   05221 Acute myeloid leukemia
    5295 (PIK3R1)
   05220 Chronic myeloid leukemia
    5295 (PIK3R1)
   05218 Melanoma
    5295 (PIK3R1)
   05211 Renal cell carcinoma
    5295 (PIK3R1)
   05215 Prostate cancer
    5295 (PIK3R1)
   05213 Endometrial cancer
    5295 (PIK3R1)
   05224 Breast cancer
    5295 (PIK3R1)
   05222 Small cell lung cancer
    5295 (PIK3R1)
   05223 Non-small cell lung cancer
    5295 (PIK3R1)
  09165 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    5295 (PIK3R1)
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    5295 (PIK3R1)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    5295 (PIK3R1)
   04931 Insulin resistance
    5295 (PIK3R1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    5295 (PIK3R1)
  09167 Infectious diseases
   05100 Bacterial invasion of epithelial cells
    5295 (PIK3R1)
   05166 HTLV-I infection
    5295 (PIK3R1)
   05162 Measles
    5295 (PIK3R1)
   05164 Influenza A
    5295 (PIK3R1)
   05161 Hepatitis B
    5295 (PIK3R1)
   05160 Hepatitis C
    5295 (PIK3R1)
   05163 Human cytomegalovirus infection
    5295 (PIK3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5295 (PIK3R1)
   05169 Epstein-Barr virus infection
    5295 (PIK3R1)
   05165 Human papillomavirus infection
    5295 (PIK3R1)
   05146 Amoebiasis
    5295 (PIK3R1)
   05142 Chagas disease (American trypanosomiasis)
    5295 (PIK3R1)
  09168 Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    5295 (PIK3R1)
   01524 Platinum drug resistance
    5295 (PIK3R1)
   01522 Endocrine resistance
    5295 (PIK3R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5295 (PIK3R1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    5295 (PIK3R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_2 SH3_9 Laminin_I Lant_dehydr_C DUF4201 Mod_r Transcrip_act
Motif
Other DBs
NCBI-GeneID: 5295
NCBI-ProteinID: NP_852664
OMIM: 171833
HGNC: 8979
Ensembl: ENSG00000145675
Vega: OTTHUMG00000131251
Pharos: P27986(Tchem)
UniProt: P27986
Structure
PDB: 

Position
5q13.1
AA seq 724 aa AA seqDB search
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKTEADVEQQALTLPDLAE
QFAPPDIAPPLLIKLVEAIEKKGLECSTLYRTQSSSNLAELRQLLDCDTPSVDLEMIDVH
VLADAFKRYLLDLPNPVIPAAVYSEMISLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTL
QYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEILISTEWNE
RQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMK
RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISEIID
SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
ENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACS
VVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA
QQRR
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctgaggggtaccagtacagagcgctgtatgattataaaaaggaaagagaagaa
gatattgacttgcacttgggtgacatattgactgtgaataaagggtccttagtagctctt
ggattcagtgatggacaggaagccaggcctgaagaaattggctggttaaatggctataat
gaaaccacaggggaaaggggggactttccgggaacttacgtagaatatattggaaggaaa
aaaatctcgcctcccacaccaaagccccggccacctcggcctcttcctgttgcaccaggt
tcttcgaaaactgaagcagatgttgaacaacaagctttgactctcccggatcttgcagag
cagtttgcccctcctgacattgccccgcctcttcttatcaagctcgtggaagccattgaa
aagaaaggtctggaatgttcaactctatacagaacacagagctccagcaacctggcagaa
ttacgacagcttcttgattgtgatacaccctccgtggacttggaaatgatcgatgtgcac
gttttggctgacgctttcaaacgctatctcctggacttaccaaatcctgtcattccagca
gccgtttacagtgaaatgatttctttagctccagaagtacaaagctccgaagaatatatt
cagctattgaagaagcttattaggtcgcctagcatacctcatcagtattggcttacgctt
cagtatttgttaaaacatttcttcaagctctctcaaacctccagcaaaaatctgttgaat
gcaagagtactctctgaaattttcagccctatgcttttcagattctcagcagccagctct
gataatactgaaaacctcataaaagttatagaaattttaatctcaactgaatggaatgaa
cgacagcctgcaccagcactgcctcctaaaccaccaaaacctactactgtagccaacaac
ggtatgaataacaatatgtccttacaagatgctgaatggtactggggagatatctcgagg
gaagaagtgaatgaaaaacttcgagatacagcagacgggacctttttggtacgagatgcg
tctactaaaatgcatggtgattatactcttacactaaggaaagggggaaataacaaatta
atcaaaatatttcatcgagatgggaaatatggcttctctgacccattaaccttcagttct
gtggttgaattaataaaccactaccggaatgaatctctagctcagtataatcccaaattg
gatgtgaaattactttatccagtatccaaataccaacaggatcaagttgtcaaagaagat
aatattgaagctgtagggaaaaaattacatgaatataacactcagtttcaagaaaaaagt
cgagaatatgatagattatatgaagaatatacccgcacatcccaggaaatccaaatgaaa
aggacagctattgaagcatttaatgaaaccataaaaatatttgaagaacagtgccagacc
caagagcggtacagcaaagaatacatagaaaagtttaaacgtgaaggcaatgagaaagaa
atacaaaggattatgcataattatgataagttgaagtctcgaatcagtgaaattattgac
agtagaagaagattggaagaagacttgaagaagcaggcagctgagtatcgagaaattgac
aaacgtatgaacagcattaaaccagaccttatccagctgagaaagacgagagaccaatac
ttgatgtggttgactcaaaaaggtgttcggcaaaagaagttgaacgagtggttgggcaat
gaaaacactgaagaccaatattcactggtggaagatgatgaagatttgccccatcatgat
gagaagacatggaatgttggaagcagcaaccgaaacaaagctgaaaacctgttgcgaggg
aagcgagatggcacttttcttgtccgggagagcagtaaacagggctgctatgcctgctct
gtagtggtggacggcgaagtaaagcattgtgtcataaacaaaacagcaactggctatggc
tttgccgagccctataacttgtacagctctctgaaagaactggtgctacattaccaacac
acctcccttgtgcagcacaacgactccctcaatgtcacactagcctacccagtatatgca
cagcagaggcgatga

DBGET integrated database retrieval system