KEGG   Homo sapiens (human): 5335Help
Entry
5335              CDS       T01001                                 

Gene name
PLCG1, NCKAP3, PLC-II, PLC1, PLC148, PLCgamma1
Definition
(RefSeq) phospholipase C gamma 1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04070  Phosphatidylinositol signaling system
hsa04072  Phospholipase D signaling pathway
hsa04360  Axon guidance
hsa04370  VEGF signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04670  Leukocyte transendothelial migration
hsa04722  Neurotrophin signaling pathway
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04919  Thyroid hormone signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05110  Vibrio cholerae infection
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05214  Glioma
hsa05223  Non-small cell lung cancer
hsa05225  Hepatocellular carcinoma
hsa05231  Choline metabolism in cancer
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Network
N00023  EGF-EGFR-PLCG-ERK signaling pathway
N00024  Mutation-activated EGFR to PLCG-ERK signaling pathway
N00025  EML4-ALK fusion kinase to PLCG-ERK signaling pathway
N00026  EGF-EGFR-PLCG-CAMK signaling pathway
N00027  Amplified EGFR to PLCG-CAMK signaling pathway
N00028  PDGF-PDGFR-PLCG-CAMK signaling pathway
N00029  Amplified PDGFR to PLCG-CAMK signaling pathway
N00147  EGF-EGFR-PLCG-calcineurin signaling pathway
N00172  KSHV K15 to PLCG-calcineurin signaling pathway
N00227  TGFA-EGFR-PLCG-PKC signaling pathway
N00228  TGFA-overexpression to PLCG-PKC signaling pathway
N00401  CXCR4-GNAQ-PLCB/G-calcineurin signaling pathway
N00432  HIV gp120 to CXCR4-GNAQ-PLCB/G-calcineurin
 » show all
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    5335 (PLCG1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5335 (PLCG1)
   04015 Rap1 signaling pathway
    5335 (PLCG1)
   04012 ErbB signaling pathway
    5335 (PLCG1)
   04370 VEGF signaling pathway
    5335 (PLCG1)
   04064 NF-kappa B signaling pathway
    5335 (PLCG1)
   04066 HIF-1 signaling pathway
    5335 (PLCG1)
   04020 Calcium signaling pathway
    5335 (PLCG1)
   04070 Phosphatidylinositol signaling system
    5335 (PLCG1)
   04072 Phospholipase D signaling pathway
    5335 (PLCG1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    5335 (PLCG1)
   04660 T cell receptor signaling pathway
    5335 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    5335 (PLCG1)
   04659 Th17 cell differentiation
    5335 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    5335 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    5335 (PLCG1)
   04670 Leukocyte transendothelial migration
    5335 (PLCG1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    5335 (PLCG1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    5335 (PLCG1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5335 (PLCG1)
  09158 Development
   04360 Axon guidance
    5335 (PLCG1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    5335 (PLCG1)
   05231 Choline metabolism in cancer
    5335 (PLCG1)
   05206 MicroRNAs in cancer
    5335 (PLCG1)
   05205 Proteoglycans in cancer
    5335 (PLCG1)
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    5335 (PLCG1)
   05214 Glioma
    5335 (PLCG1)
   05223 Non-small cell lung cancer
    5335 (PLCG1)
  09167 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    5335 (PLCG1)
  09171 Infectious diseases: Bacterial
   05110 Vibrio cholerae infection
    5335 (PLCG1)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    5335 (PLCG1)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    5335 (PLCG1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5335 (PLCG1)
  09176 Drug resistance: Antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    5335 (PLCG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5335 (PLCG1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     5335 (PLCG1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    5335 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    5335 (PLCG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 PH SH3_1 SH3_9 SH3_2 PH_12 GDPD
Motif
Other DBs
NCBI-GeneID: 5335
NCBI-ProteinID: NP_877963
OMIM: 172420
HGNC: 9065
Ensembl: ENSG00000124181
Vega: OTTHUMG00000033082
Pharos: P19174(Tchem)
UniProt: P19174 Q4LE43
Structure
PDB: 

Position
20q12
AA seq 1290 aa AA seqDB search
MAGAASPCANGCGPGAPSDAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQI
TWSRGADKIEGAIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTL
SLQATSEDEVNMWIKGLTWLMEDTLQAPTPLQIERWLRKQFYSVDRNREDRISAKDLKNM
LSQVNYRVPNMRFLRERLTDLEQRSGDITYGQFAQLYRSLMYSAQKTMDLPFLEASTLRA
GERPELCRVSLPEFQQFLLDYQGELWAVDRLQVQEFMLSFLRDPLREIEEPYFFLDEFVT
FLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMG
CRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIA
QQRNMAQYFKKVLGDTLLTKPVEISADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSMM
YSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEVSS
STELHSNEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFW
RNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQT
NAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQE
GQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNP
GFYVEANPMPTFKCAVKALFDYKAQREDELTFIKSAIIQNVEKQEGGWWRGDYGGKKQLW
FPSNYVEEMVNPVALEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSIS
MASVAHWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKIMERRKKIALELSELVVYC
RPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDS
SNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMTGRHCGYVLQPSTMRDEAFDPFDKS
SLRGLEPCAISIEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSTKQKTEFVVDNGLNPVW
PAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEDL
ELASLLIKIDIFPAKENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDF
RISQEHLADHFDSRERRAPRRTRVNGDNRL
NT seq 3873 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgccgcgtccccttgcgccaacggctgcgggcccggcgcgccctcggacgcc
gaggtgctgcacctctgccgcagcctcgaggtgggcaccgtcatgactttgttctactcc
aagaagtcgcagcgacccgagcggaagaccttccaggtcaagctggagacgcgccagatc
acgtggagccggggcgccgacaagatcgagggggccattgacattcgtgaaattaaggag
atccgcccagggaagacctcacgggactttgatcgctatcaagaggacccagctttccgg
ccggaccagtcacattgctttgtcattctctatggaatggaatttcgcctgaaaacgctg
agcctgcaagccacatctgaggatgaagtgaacatgtggatcaagggcttaacttggctg
atggaggatacattgcaggcacccacacccctgcagattgagaggtggctccggaagcag
ttttactcagtggatcggaatcgtgaggatcgtatatcagccaaggacctgaagaacatg
ctgtcccaggtcaactaccgggtccccaacatgcgcttcctccgagagcggctgacggac
ctggagcagcgcagcggggacatcacctacgggcagtttgctcagctgtaccgcagcctc
atgtacagcgcccagaagacgatggacctccccttcttggaagccagtactctgagggct
ggggagcggccggagctttgccgagtgtcccttcctgagttccagcagttccttcttgac
taccagggggagctgtgggctgttgatcgcctccaggtgcaggagttcatgctcagcttc
ctccgagaccccttacgagagatcgaggagccatacttcttcctggatgagtttgtcacc
ttcctgttctccaaagagaacagtgtgtggaactcgcagctggatgcagtatgcccggac
accatgaacaaccctctttcccactactggatctcctcctcgcacaacacgtacctgacc
ggggaccagttctccagtgagtcctccttggaagcctatgctcgctgcctgcggatgggc
tgtcgctgcattgagttggactgctgggacggcccggatgggatgccagttatttaccat
gggcacacccttaccaccaagatcaagttctcagatgtcctgcacaccatcaaggagcat
gcctttgtggcctcagagtacccagtcatcctgtccattgaggaccactgcagcattgcc
cagcagagaaacatggcccaatacttcaagaaggtgctgggggacacactcctcaccaag
cccgtggagatctctgccgacgggctcccctcacccaaccagcttaagaggaagatcctc
atcaagcacaagaagctggctgagggcagtgcctacgaggaggtgcctacatccatgatg
tactctgagaacgacatcagcaactctatcaagaatggcatcctctacctggaggaccct
gtgaaccacgaatggtatccccactactttgttctgaccagcagcaagatctactactct
gaggagaccagcagtgaccagggcaacgaggatgaggaggagcccaaggaggtcagcagc
agcacagagctgcactccaatgagaagtggttccatgggaagctaggggcagggcgtgac
gggcgtcacatcgctgagcgcctgcttactgagtactgcatcgagaccggagcccctgac
ggctccttcctcgtgcgagagagtgagaccttcgtgggcgactacacgctctctttctgg
cggaacgggaaagtccagcactgccgtatccactcccggcaagatgctgggacccccaag
ttcttcttgacagacaacctcgtctttgactccctctatgacctcatcacgcactaccag
caggtgcccctgcgctgtaatgagtttgagatgcgactttcagagcctgtcccacagacc
aacgcccacgagagcaaagagtggtaccacgcgagcctgaccagagcacaggctgagcac
atgctaatgcgcgtccctcgtgatggggccttcctggtgcggaagcggaatgaacccaac
tcatatgccatctctttccgggctgagggcaagatcaagcattgccgtgtccagcaagag
ggccagacagtgatgctagggaactcggagttcgacagccttgttgacctcatcagctac
tatgagaaacacccgctataccgcaagatgaagctgcgctatcccatcaacgaggaggca
ctggagaagattggcacagctgagcctgactacggggccctgtatgagggacgcaaccct
ggcttctatgtagaggcaaaccctatgccaactttcaagtgtgcagtcaaagccctcttt
gactacaaggcccagagggaggacgagctgaccttcatcaagagcgccatcatccagaat
gtggagaagcaagagggaggctggtggcgaggggactacggagggaagaagcagctgtgg
ttcccatcaaactacgtggaagagatggtcaaccccgtggccctggagccggagagggag
cacttggacgagaacagccccctaggggacttgctgcggggggtcttggatgtgccggct
tgtcagattgccatccgtcctgagggcaagaacaaccggctcttcgtcttctccatcagc
atggcgtcggtggcccactggtccctggatgttgctgccgactcacaggaggagctgcag
gactgggtgaaaaagatccgtgaagtggcccagacagcagacgccaggctcactgaaggg
aagataatggaacggaggaagaagattgccctggagctctctgaacttgtcgtctactgc
cggcctgttccctttgatgaagagaagattggcacagaacgtgcttgctaccgggacatg
tcatccttcccggaaaccaaggctgagaaatacgtgaacaaggccaaaggcaagaagttc
cttcagtacaatcgactgcagctctcccgcatctaccccaagggccagcgactggattcc
tccaactacgatcctttgcccatgtggatctgtggcagtcagcttgtggccctcaacttc
cagacccctgacaagcctatgcagatgaaccaggccctcttcatgacgggcaggcactgt
ggctacgtgctgcagccaagcaccatgcgggatgaggccttcgacccctttgacaagagc
agcctccgcgggctggagccatgtgccatctctattgaggtgctgggggcccgacatctg
ccaaagaatggccgaggcattgtgtgtccttttgtggagattgaggtggctggagctgag
tatgacagcaccaagcagaagacagagtttgtggtggacaatggactcaaccctgtatgg
ccagccaagcccttccacttccagatcagtaaccctgaatttgcctttctgcgcttcgtg
gtgtatgaggaagacatgtttagtgaccagaatttcctggctcaggctactttcccagta
aaaggcctgaagacaggatacagagcagtgcctttgaagaacaactacagtgaggacctg
gagttggcctccctgctgatcaagattgacattttccctgccaaggagaatggtgacctc
agtcccttcagtggtacgtccctgcgggagcggggctcagatgcctcaggccagctgttt
catggccgagcccgggaaggctcctttgaatcccgctaccagcagccgtttgaggacttc
cgcatctcccaggagcatctcgcagaccattttgacagtcgagaacgaagggccccaaga
aggactcgggtcaatggagacaaccgcctctag

DBGET integrated database retrieval system