KEGG   Homo sapiens (human): 54512
Entry
54512             CDS       T01001                                 

Symbol
EXOSC4, RRP41, RRP41A, Rrp41p, SKI6, Ski6p, hRrp41p, p12A
Name
(RefSeq) exosome component 4
  KO
K11600  exosome complex component RRP41
Organism
hsa  Homo sapiens (human)
Pathway
hsa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    54512 (EXOSC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    54512 (EXOSC4)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     54512 (EXOSC4)
 Prokaryotic type
  Archeal mRNA degradation factors
   Exosome components
    Cofactors
     54512 (EXOSC4)
SSDB
Motif
Pfam: RNase_PH RNase_PH_C
Other DBs
NCBI-GeneID: 54512
NCBI-ProteinID: NP_061910
OMIM: 606491
HGNC: 18189
Ensembl: ENSG00000178896
Vega: OTTHUMG00000165437
Pharos: Q9NPD3(Tbio)
UniProt: Q9NPD3
Structure
PDB: 
2NN6 6D6Q 6D6R 6H25

Position
8q24.3
AA seq 245 aa
MAGLELLSDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHEIRG
SRARALPDRALVNCQYSSATFSTGERKRRPHGDRKSCEMGLQLRQTFEAAILTQLHPRSQ
IDIYVQVLQADGGTYAACVNAATLAVLDAGIPMRDFVCACSAGFVDGTALADLSHVEEAA
GGPQLALALLPASGQIALLEMDARLHEDHLERVLEAAAQAARDVHTLLDRVVRQHVREAS
ILLGD
NT seq 738 nt   +upstreamnt  +downstreamnt
atggcggggctggagctcttgtcggaccagggctaccgggtggacgggcggcgcgccggg
gagctgcgcaagatccaggcgcggatgggcgtgttcgcgcaggctgacggctcggcctac
attgagcagggcaacaccaaggcactggctgtggtctacggcccgcacgagatccggggc
tcccgggctcgagccctgccggacagggccctagtgaactgtcaatatagttcagcgacc
ttcagcacaggtgagcgcaagcgacggccacatggggaccgtaagtcctgtgagatgggc
ctgcagctccgccagactttcgaagcagccatcctcacacagctgcacccacgctcccag
attgatatctatgtgcaggtgctacaggcagatggtgggacctatgcagcttgtgtgaat
gcagccacgctggcagtgctggatgccgggatacccatgagagactttgtgtgtgcgtgc
tcagctggcttcgtggacggcacagccctggcggacctcagccatgtggaggaagcagct
ggtggcccccagctggccctggccctgctgccagcctcaggacagattgcgctgcttgag
atggatgcccggctgcacgaggaccacctggagcgggtgttggaggctgctgcccaggct
gcccgagatgtgcacaccctcttagatcgagtggtccggcagcatgtgcgtgaggcctct
atcttgctgggggactga

DBGET integrated database retrieval system