KEGG   Homo sapiens (human): 54514Help
Entry
54514             CDS       T01001                                 

Gene name
DDX4, VASA
Definition
(RefSeq) DEAD-box helicase 4
  KO
K13982  probable ATP-dependent RNA helicase DDX4 [EC:3.6.4.13]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    54514 (DDX4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     54514 (DDX4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Gene silencing
   piRNA pathway
    54514 (DDX4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C ResIII
Motif
Other DBs
NCBI-GeneID: 54514
NCBI-ProteinID: NP_077726
OMIM: 605281
HGNC: 18700
Ensembl: ENSG00000152670
Vega: OTTHUMG00000097044
Pharos: Q9NQI0(Tbio)
UniProt: Q9NQI0
Position
5q11.2
AA seq 724 aa AA seqDB search
MGDEDWEAEINPHMSSYVPIFEKDRYSGENGDNFNRTPASSSEMDDGPSRRDHFMKSGFA
SGRNFGNRDAGECNKRDNTSTMGGFGVGKSFGNRGFSNSRFEDGDSSGFWRESSNDCEDN
PTRNRGFSKRGGYRDGNNSEASGPYRRGGRGSFRGCRGGFGLGSPNNDLDPDECMQRTGG
LFGSRRPVLSGTGNGDTSQSRSGSGSERGGYKGLNEEVITGSGKNSWKSEAEGGESSDTQ
GPKVTYIPPPPPEDEDSIFAHYQTGINFDKYDTILVEVSGHDAPPAILTFEEANLCQTLN
NNIAKAGYTKLTPVQKYSIPIILAGRDLMACAQTGSGKTAAFLLPILAHMMHDGITASRF
KELQEPECIIVAPTRELVNQIYLEARKFSFGTCVRAVVIYGGTQLGHSIRQIVQGCNILC
ATPGRLMDIIGKEKIGLKQIKYLVLDEADRMLDMGFGPEMKKLISCPGMPSKEQRQTLMF
SATFPEEIQRLAAEFLKSNYLFVAVGQVGGACRDVQQTVLQVGQFSKREKLVEILRNIGD
ERTMVFVETKKKADFIATFLCQEKISTTSIHGDREQREREQALGDFRFGKCPVLVATSVA
ARGLDIENVQHVINFDLPSTIDEYVHRIGRTGRCGNTGRAISFFDLESDNHLAQPLVKVL
TDAQQDVPAWLEEIAFSTYIPGFSGSTRGNVFASVDTRKGKSTLNTAGFSSSQAPNPVDD
ESWD
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgggagatgaagattgggaagcagaaatcaaccctcatatgtcttcctatgttcccata
tttgagaaggataggtattctggagaaaatggagacaattttaacaggactccagcttca
tcatcagaaatggatgatggaccttctcgaagagatcatttcatgaaaagtggatttgcc
tctgggcggaattttggaaacagagatgctggtgagtgtaataagcgagataatacatcc
acaatgggtggttttggagttggaaagagttttggaaacagaggtttttcaaacagcagg
tttgaagatggtgatagctctggtttctggagagagtctagtaatgactgcgaagataat
ccaacacggaacagagggttttccaagagaggcggctatcgagatggaaataattcagaa
gcttcagggccatacagaagaggtggaagaggtagtttccgaggttgccgtggaggattt
ggtctaggaagtccaaataatgacttagacccagacgaatgtatgcagcgcactggtggc
ctttttggttctagaagaccagtattaagtggcacaggtaatggtgatacttctcaaagc
agaagtggcagtggaagtgaacgaggtggttacaaaggtttaaatgaagaagtaataaca
ggctctggaaagaattcttggaagtcagaagcagaaggaggagaaagtagtgatactcaa
ggaccaaaagtgacctacataccccctcctccacctgaggatgaggactccatctttgca
cattatcagacaggcataaacttcgacaaatacgacactattcttgtggaagtgtctgga
catgatgcaccaccagcaattctgacttttgaagaagctaatctctgtcagacactgaat
aacaacattgctaaagctggttatactaagcttactcctgtgcaaaaatacagtattcct
atcatacttgcaggacgagatttgatggcttgcgctcaaacagggtctgggaagactgcg
gcttttctcctaccaattttggctcatatgatgcatgatggaataactgccagtcgtttt
aaagagttgcaggaaccagagtgtattattgtagcaccaactcgagaattggtcaaccag
atttatttggaagccagaaaattttcttttgggacttgtgtaagagctgttgttatatat
gggggaacccagctgggacattcaattcgacaaatagtacaaggctgtaatatattatgt
gctactcctggaagactgatggatatcataggcaaagaaaagattggtctcaaacagatc
aaatacttagttttggatgaagctgatcgcatgttggatatgggttttggtccagaaatg
aagaagttaatttcttgcccaggaatgccatcaaaggaacagcgccaaacccttatgttc
agtgcaacttttccagaggaaattcaaaggttggctgcagagtttttaaagtcaaattat
ctgtttgttgctgttggacaagtgggtggagcatgtagagatgttcagcagaccgttctc
caagttggccagttctcaaaaagagaaaagctcgttgaaattctgcgaaacataggggat
gaaagaactatggtctttgttgaaactaagaaaaaagcagattttattgcaacttttctt
tgtcaagaaaaaatatcaactacaagtattcatggtgatcgggaacagagagagcgggag
caagctcttggagattttcgctttggaaagtgcccagttcttgttgctacttcagtagct
gccagagggctggatattgaaaatgtgcaacatgttatcaattttgatcttccttctacc
attgatgaatatgttcatcgaattgggcgtactggtcgttgtgggaatactggcagagca
atttccttttttgatcttgaatcggataaccatttagcacagcctctagtaaaagtattg
acagatgctcaacaggatgttcctgcatggttggaagaaattgcctttagtacatacatt
cctggcttcagtggtagtacaagaggaaacgtgtttgcatcagttgataccagaaagggc
aagagcactttgaacacagctgggttttcttcttcacaagctcccaatccagtagatgat
gagtcatgggattaa

DBGET integrated database retrieval system