KEGG   Homo sapiens (human): 54522Help
Entry
54522             CDS       T01001                                 

Gene name
ANKRD16
Definition
(RefSeq) ankyrin repeat domain 16
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank_3 Ank Ank_5
Motif
Other DBs
NCBI-GeneID: 54522
NCBI-ProteinID: NP_001009941
OMIM: 618017
HGNC: 23471
Ensembl: ENSG00000134461
Vega: OTTHUMG00000017610
Pharos: Q6P6B7(Tdark)
UniProt: Q6P6B7
Position
10p15.1
AA seq 361 aa AA seqDB search
MAQPGDPRRLCRLVQEGRLRALKEELQAAGGCPGPAGDTLLHCAARHGHRDVLAYLAEAW
GMDIEATNRDYKRPLHEAASMGHRDCVRYLLGRGAAVDCLKKADWTPLMMACTRKNLGVI
QELVEHGANPLLKNKDGWNSFHIASREGDPLILQYLLTVCPGAWKTESKIRRTPLHTAAM
HGHLEAVKVLLKRCQYEPDYRDNCGVTALMDAIQCGHIDVARLLLDEHGACLSAEDSLGA
QALHRAAVTGQDEAIRFLVSELGVDVDVRATSTHLTALHYAAKEGHTSTIQTLLSLGADI
NSKDEKNRSALHLACAGQHLACAKFLLQSGLKDSEDITGTLAQQLPRRADVLQGSGHSAM
T
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcccggggacccgcggcgcctctgcaggctggtgcaggagggccggctgcgc
gccctgaaggaggagctgcaggcggccgggggctgcccggggccggccggggataccctc
ctgcactgcgccgcgcgccacgggcatcgggacgtgctggcctatctggccgaggcctgg
ggcatggacatcgaggccaccaaccgagactacaagcggcctctgcacgaggcggcctcc
atgggccaccgagactgcgtgcgctacctgctgggccggggggcagcggtcgactgcctg
aagaaggccgactggactcctctgatgatggcctgcacaaggaagaacctgggggtgatc
caggagctggtggaacatggcgccaatccactcctgaagaacaaagatggctggaacagt
ttccacattgccagtcgagaaggcgaccctctgatcctccagtacctgctcactgtttgc
ccaggtgcctggaagacagagagcaaaattagaaggactcctctgcatactgcagcaatg
catggccatttggaggcagtcaaggtgcttcttaagaggtgccaatatgaaccagactac
agagacaactgtggcgtcaccgccttgatggacgcaatccagtgtgggcacatcgacgtc
gctaggctgctcctcgatgaacatggggcttgcctttcagcagaagacagcctgggtgcc
caggctctgcacagggcagctgtcacagggcaggacgaagccatccgattcttggtctct
gaacttggcgtcgatgtagatgtgagagccacatcaacccacctcacagcacttcattat
gcagctaaggaaggacatacaagtacaattcagactctcttatccttgggagctgacatc
aattctaaagatgaaaaaaatcgatcagccctgcatctggcctgtgcaggtcagcacttg
gcctgtgccaagtttctcctgcagtcgggactgaaggattctgaagacatcacgggcacc
ctggctcagcagctcccaaggagagcagatgtccttcagggctctggccatagcgcaatg
acataa

DBGET integrated database retrieval system