KEGG   Homo sapiens (human): 54538
Entry
54538             CDS       T01001                                 

Gene name
ROBO4, AOVD3, ECSM4, MRB
Definition
(RefSeq) roundabout guidance receptor 4
  KO
K06784  roundabout, axon guidance receptor 4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    54538 (ROBO4)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  ROBO family
   54538 (ROBO4)
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 ig fn3 C2-set_2 V-set BiPBP_C
Other DBs
NCBI-GeneID: 54538
NCBI-ProteinID: NP_061928
OMIM: 607528
HGNC: 17985
Ensembl: ENSG00000154133
Vega: OTTHUMG00000165936
Pharos: Q8WZ75(Tbio)
UniProt: Q8WZ75
Position
11q24.2
AA seq 1007 aa
MGSGGDSLLGGRGSLPLLLLLIMGGMAQDSPPQILVHPQDQLFQGPGPARMSCQASGQPP
PTIRWLLNGQPLSMVPPDPHHLLPDGTLLLLQPPARGHAHDGQALSTDLGVYTCEASNRL
GTAVSRGARLSVAVLREDFQIQPRDMVAVVGEQFTLECGPPWGHPEPTVSWWKDGKPLAL
QPGRHTVSGGSLLMARAEKSDEGTYMCVATNSAGHRESRAARVSIQEPQDYTEPVELLAV
RIQLENVTLLNPDPAEGPKPRPAVWLSWKVSGPAAPAQSYTALFRTQTAPGGQGAPWAEE
LLAGWQSAELGGLHWGQDYEFKVRPSSGRARGPDSNVLLLRLPEKVPSAPPQEVTLKPGN
GTVFVSWVPPPAENHNGIIRGYQVWSLGNTSLPPANWTVVGEQTQLEIATHMPGSYCVQV
AAVTGAGAGEPSRPVCLLLEQAMERATQEPSEHGPWTLEQLRATLKRPEVIATCGVALWL
LLLGTAVCIHRRRRARVHLGPGLYRYTSEDAILKHRMDHSDSQWLADTWRSTSGSRDLSS
SSSLSSRLGADARDPLDCRRSLLSWDSRSPGVPLLPDTSTFYGSLIAELPSSTPARPSPQ
VPAVRRLPPQLAQLSSPCSSSDSLCSRRGLSSPRLSLAPAEAWKAKKKQELQHANSSPLL
RGSHSLELRACELGNRGSKNLSQSPGAVPQALVAWRALGPKLLSSSNELVTRHLPPAPLF
PHETPPTQSQQTQPPVAPQAPSSILLPAAPIPILSPCSPPSPQASSLSGPSPASSRLSSS
SLSSLGEDQDSVLTPEEVALCLELSEGEETPRNSVSPMPRAPSPPTTYGYISVPTASEFT
DMGRTGGGVGPKGGVLLCPPRPCLTPTPSEGSLANGWGSASEDNAASARASLVSSSDGSF
LADAHFARALAVAVDSFGFGLEPREADCVFIDASSPPSPRDEIFLTPNLSLPLWEWRPDW
LEDMEVSHTQRLGRGMPPWPPDSQISSQRSQLHCRMPKAGASPVDYS
NT seq 3024 nt   +upstreamnt  +downstreamnt
atgggctctggaggagacagcctcctggggggcaggggttccctgcctctgctgctcctg
ctcatcatgggaggcatggctcaggactccccgccccagatcctagtccacccccaggac
cagctgttccagggccctggccctgccaggatgagctgccaagcctcaggccagccacct
cccaccatccgctggttgctgaatgggcagcccctgagcatggtgcccccagacccacac
cacctcctgcctgatgggacccttctgctgctacagccccctgcccggggacatgcccac
gatggccaggccctgtccacagacctgggtgtctacacatgtgaggccagcaaccggctt
ggcacggcagtcagcagaggcgctcggctgtctgtggctgtcctccgggaggatttccag
atccagcctcgggacatggtggctgtggtgggtgagcagtttactctggaatgtgggccg
ccctggggccacccagagcccacagtctcatggtggaaagatgggaaacccctggccctc
cagcccggaaggcacacagtgtccggggggtccctgctgatggcaagagcagagaagagt
gacgaagggacctacatgtgtgtggccaccaacagcgcaggacatagggagagccgcgca
gcccgggtttccatccaggagccccaggactacacggagcctgtggagcttctggctgtg
cgaattcagctggaaaatgtgacactgctgaacccggatcctgcagagggccccaagcct
agaccggcggtgtggctcagctggaaggtcagtggccctgctgcgcctgcccaatcttac
acggccttgttcaggacccagactgccccgggaggccagggagctccgtgggcagaggag
ctgctggccggctggcagagcgcagagcttggaggcctccactggggccaagactacgag
ttcaaagtgagaccatcctctggccgggctcgaggccctgacagcaacgtgctgctcctg
aggctgccggaaaaagtgcccagtgccccacctcaggaagtgactctaaagcctggcaat
ggcactgtctttgtgagctgggtcccaccacctgctgaaaaccacaatggcatcatccgt
ggctaccaggtctggagcctgggcaacacatcactgccaccagccaactggactgtagtt
ggtgagcagacccagctggaaatcgccacccatatgccaggctcctactgcgtgcaagtg
gctgcagtcactggtgctggagctggggagcccagtagacctgtctgcctccttttagag
caggccatggagcgagccacccaagaacccagtgagcatggtccctggaccctggagcag
ctgagggctaccttgaagcggcctgaggtcattgccacctgcggtgttgcactctggctg
ctgcttctgggcaccgccgtgtgtatccaccgccggcgccgagctagggtgcacctgggc
ccaggtctgtacagatataccagtgaggatgccatcctaaaacacaggatggatcacagt
gactcccagtggttggcagacacttggcgttccacctctggctctcgggacctgagcagc
agcagcagcctcagcagtcggctgggggcggatgcccgggacccactagactgtcgtcgc
tccttgctctcctgggactcccgaagccccggcgtgcccctgcttccagacaccagcact
ttttatggctccctcatcgctgagctgccctccagtaccccagccaggccaagtccccag
gtcccagctgtcaggcgcctcccaccccagctggcccagctctccagcccctgttccagc
tcagacagcctctgcagccgcaggggactctcttctccccgcttgtctctggcccctgca
gaggcttggaaggccaaaaagaagcaggagctgcagcatgccaacagttccccactgctc
cggggcagccactccttggagctccgggcctgtgagttaggaaatagaggttccaagaac
ctttcccaaagcccaggagctgtgccccaagctctggttgcctggcgggccctgggaccg
aaactcctcagctcctcaaatgagctggttactcgtcatctccctccagcacccctcttt
cctcatgaaactcccccaactcagagtcaacagacccagcctccggtggcaccacaggct
ccctcctccatcctgctgccagcagcccccatccccatccttagcccctgcagtccccct
agcccccaggcctcttccctctctggccccagcccagcttccagtcgcctgtccagctcc
tcactgtcatccctgggggaggatcaagacagcgtgctgacccctgaggaggtagccctg
tgcttggaactcagtgagggtgaggagactcccaggaacagcgtctctcccatgccaagg
gctccttcaccccccaccacctatgggtacatcagcgtcccaacagcctcagagttcacg
gacatgggcaggactggaggaggggtggggcccaaggggggagtcttgctgtgcccacct
cggccctgcctcacccccacccccagcgagggctccttagccaatggttggggctcagcc
tctgaggacaatgccgccagcgccagagccagccttgtcagctcctccgatggctccttc
ctcgctgatgctcactttgcccgggccctggcagtggctgtggatagctttggtttcggt
ctagagcccagggaggcagactgcgtcttcatagatgcctcatcacctccctccccacgg
gatgagatcttcctgacccccaacctctccctgcccctgtgggagtggaggccagactgg
ttggaagacatggaggtcagccacacccagcggctgggaagggggatgcctccctggccc
cctgactctcagatctcttcccagagaagtcagctccactgtcgtatgcccaaggctggt
gcttctcctgtagattactcctga

DBGET integrated database retrieval system