KEGG   Homo sapiens (human): 54807
Entry
54807             CDS       T01001                                 
Symbol
ZNF586
Name
(RefSeq) zinc finger protein 586
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    54807 (ZNF586)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    54807 (ZNF586)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    54807 (ZNF586)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz KRAB zf_UBZ zf-LYAR Zn-ribbon_8 zf-met zf-C2H2_8 zf-C2H2_11 zf-C2HC_2 C1_4 Zn_ribbon_SprT
Other DBs
NCBI-GeneID: 54807
NCBI-ProteinID: NP_060122
HGNC: 25949
Ensembl: ENSG00000083828
UniProt: Q9NXT0
Position
19:57769676..57780616
AA seq 402 aa
MAAAAALRAPAQSSVTFEDVAVNFSLEEWSLLNEAQRCLYRDVMLETLTLISSLGCWHGG
EDEAAPSKQSTCIHIYKDQGGHSGERPYECGEYRKLFKNKSCLTEPRRDHKHRNVRTGER
PYECSKYGKLFHQKPTLHIHERFHTGQKTYECSECGKSFHQSSSLLQRQTLHTRERPYEC
IECGKAFAEKSSLINHRKVHSGAKRYECNECGKSFAYTSSLIKHRRIHTGERPYECSECG
RSFAENSSLIKHLRVHTGERPYECVECGKSFRRSSSLLQHQRVHTRERPYECSECGKSFS
LRSNLIHHQRVHTGERHECGQCGKSFSRKSSLIIHLRVHTGERPYECSDCGKSFAENSSL
IKHLRVHTGERPYECIDCGKSFRHSSSFRRHQRVHTGMRPYK
NT seq 1209 nt   +upstreamnt  +downstreamnt
atggcggcagcagccgctctgagggcgcctgctcagagcagtgtgacctttgaagatgtg
gctgtaaacttttccctggaggaatggagtcttcttaatgaggctcagagatgcctgtac
cgtgacgtgatgctggagaccttgacacttatatcctccctgggttgttggcatggaggg
gaagatgaggcagcaccttctaagcagagcacgtgtatacatatatacaaagaccaggga
ggtcatagtggagaaaggccttatgagtgtggggaatataggaaattatttaagaacaag
tcctgcctcactgaacccagaagagatcacaaacacaggaatgttcgcactggagaaagg
ccttatgagtgcagcaaatatgggaaattatttcaccaaaagcctacactccatattcat
gagagatttcatactgggcaaaagacctatgagtgcagtgagtgtggaaaatcatttcac
caaagctcttcactcttgcagcgtcagacacttcacactagagaaaggccttatgagtgt
attgaatgtgggaaagcctttgctgaaaagtccagtctcattaaccacaggaaagttcac
tctggagcaaagcgttatgaatgcaatgaatgtgggaagtcctttgcttatacatctagt
ctcattaaacacaggaggattcacactggagagaggccttatgagtgcagtgaatgtggg
agatcctttgctgaaaactccagtcttattaaacacttgagagttcacacaggagaaagg
ccttatgaatgcgttgagtgtggaaaatcatttcgccgaagctcttcactcttgcagcat
cagagagttcacactagagaaaggccttatgaatgtagtgaatgtgggaaatcctttagc
ttaaggtccaacctcattcaccatcagcgagttcatactggagaaaggcatgagtgcggg
cagtgtgggaaatcctttagccgaaaatctagccttattatacatctgagagttcacact
ggagaaaggccttatgagtgcagtgactgtgggaaatcctttgctgaaaactccagcctt
attaaacacttgagagttcacactggagaaaggccatatgaatgcattgattgtggaaaa
tcatttcgccacagttcttcgttccgtcgccatcagagagttcatactggaatgaggcct
tataagtga

DBGET integrated database retrieval system