KEGG   Homo sapiens (human): 54904
Entry
54904             CDS       T01001                                 

Gene name
NSD3, KMT3F, KMT3G, WHISTLE, WHSC1L1, pp14328
Definition
(RefSeq) nuclear receptor binding SET domain protein 3
  KO
K11425  [histone H3]-lysine4 N-dimethyltransferase / [histone H3]-lysine27 N-dimethyltransferase [EC:2.1.1.370 2.1.1.371]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00310  Lysine degradation
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    54904 (NSD3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    54904 (NSD3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.370  [histone H3]-lysine4 N-dimethyltransferase
     54904 (NSD3)
    2.1.1.371  [histone H3]-lysine27 N-dimethyltransferase
     54904 (NSD3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     54904 (NSD3)
SSDB
Motif
Pfam: PWWP C5HCH SET AWS PHD zf-HC5HC2H_2 zf-HC5HC2H
Other DBs
NCBI-GeneID: 54904
NCBI-ProteinID: NP_075447
OMIM: 607083
HGNC: 12767
Ensembl: ENSG00000147548
Vega: OTTHUMG00000165115
Pharos: Q9BZ95(Tbio)
UniProt: Q9BZ95
Structure
PDB: 

Position
8p11.23
AA seq 1437 aa
MDFSFSFMQGIMGNTIQQPPQLIDSANIRQEDAFDNNSDIAEDGGQTPYEATLQQGFQYP
ATTEDLPPLTNGYPSSISVYETQTKYQSYNQYPNGSANGFGAVRNFSPTDYYHSEIPNTR
PHEILEKPSPPQPPPPPSVPQTVIPKKTGSPEIKLKITKTIQNGRELFESSLCGDLLNEV
QASEHTKSKHESRKEKRKKSNKHDSSRSEERKSHKIPKLEPEEQNRPNERVDTVSEKPRE
EPVLKEEAPVQPILSSVPTTEVSTGVKFQVGDLVWSKVGTYPWWPCMVSSDPQLEVHTKI
NTRGAREYHVQFFSNQPERAWVHEKRVREYKGHKQYEELLAEATKQASNHSEKQKIRKPR
PQRERAQWDIGIAHAEKALKMTREERIEQYTFIYIDKQPEEALSQAKKSVASKTEVKKTR
RPRSVLNTQPEQTNAGEVASSLSSTEIRRHSQRRHTSAEEEEPPPVKIAWKTAAARKSLP
ASITMHKGSLDLQKCNMSPVVKIEQVFALQNATGDGKFIDQFVYSTKGIGNKTEISVRGQ
DRLIISTPNQRNEKPTQSVSSPEATSGSTGSVEKKQQRRSIRTRSESEKSTEVVPKKKIK
KEQVETVPQATVKTGLQKGASEISDSCKPLKKRSRASTDVEMTSSAYRDTSDSDSRGLSD
LQVGFGKQVDSPSATADADVSDVQSMDSSLSRRGTGMSKKDTVCQICESSGDSLIPCEGE
CCKHFHLECLGLASLPDSKFICMECKTGQHPCFSCKVSGKDVKRCSVGACGKFYHEACVR
KFPTAIFESKGFRCPQHCCSACSMEKDIHKASKGRMMRCLRCPVAYHSGDACIAAGSMLV
SSYILICSNHSKRSSNSSAVNVGFCFVCARGLIVQDHSDPMFSSYAYKSHYLLNESNRAE
LMKLPMIPSSSASKKKCEKGGRLLCCESCPASFHPECLSIEMPEGCWNCNDCKAGKKLHY
KQIVWVKLGNYRWWPAEICNPRSVPLNIQGLKHDLGDFPVFFFGSHDYYWVHQGRVFPYV
EGDKSFAEGQTSINKTFKKALEEAAKRFQELKAQRESKEALEIEKNSRKPPPYKHIKANK
VIGKVQIQVADLSEIPRCNCKPADENPCGLESECLNRMLQYECHPQVCPAGDRCQNQCFT
KRLYPDAEIIKTERRGWGLRTKRSIKKGEFVNEYVGELIDEEECRLRIKRAHENSVTNFY
MLTVTKDRIIDAGPKGNYSRFMNHSCNPNCETQKWTVNGDVRVGLFALCDIPAGMELTFN
YNLDCLGNGRTECHCGADNCSGFLGVRPKSACASTNEEKAKNAKLKQKRRKIKTEPKQMH
EDYCFQCGDGGELVMCDKKDCPKAYHLLCLNLTQPPYGKWECPWHQCDECSSAAVSFCEF
CPHSFCKDHEKGALVPSALEGRLCCSEHDPMAPVSPEYWSKIKCKWESQDHGEEVKE
NT seq 4314 nt   +upstreamnt  +downstreamnt
atggatttctctttctctttcatgcaagggatcatgggaaacacaattcagcaaccacct
caactcattgactccgccaacatccgtcaggaggatgcctttgataacaacagtgacatt
gctgaagatggtggccagacaccatatgaagctactttgcagcaaggctttcagtaccca
gctacaacagaagatcttcctccactcacaaatgggtatccatcatcaatcagtgtgtat
gaaactcaaaccaaataccagtcatataatcagtatcctaatgggtcagccaatggcttt
ggtgcagttagaaactttagccccactgactattatcattcagaaattccaaacacaaga
ccacatgaaattctggaaaaaccttcccctccacagccaccacctcctccttcggtacca
caaactgtgattccaaagaagactggctcacctgaaattaaactaaaaataaccaaaact
atccagaatggcagggaattgtttgagtcttccctttgtggagaccttttaaatgaagta
caggcaagtgagcacacgaaatcaaagcatgaaagcagaaaagaaaagaggaaaaaaagc
aacaagcatgactcatcaagatctgaagagcgcaagtcacacaaaatccccaaattagaa
ccagaggaacaaaatagaccaaatgagagggttgacactgtatcagaaaaaccaagggaa
gaaccagtactaaaagaggaagccccagttcagccaatactatcttctgttccaacaacg
gaagtgtccactggtgttaagtttcaggttggcgatcttgtgtggtccaaggtgggaacc
tatccttggtggccttgtatggtttcaagtgatccccagcttgaggttcatactaaaatt
aacacaagaggtgcccgagaatatcatgtccagttttttagcaaccagccagagagggcg
tgggttcatgaaaaacgggtacgagagtataaaggtcataaacagtatgaagaattactg
gctgaggcaaccaaacaagccagcaatcactctgagaaacaaaagattcggaaaccccga
cctcagagagaacgtgctcagtgggatattggcattgcccatgcagagaaagcattgaaa
atgactcgagaagaaagaatagaacagtatacttttatttacattgataaacagcctgaa
gaggctttatcccaagcaaaaaagagtgttgcctccaaaaccgaagttaaaaaaacccga
cgaccaagatctgtgctgaatactcagccagaacagaccaatgcaggggaggtggcctcc
tcactctcaagtactgaaattcggagacatagccagaggcggcacacaagtgcggaagag
gaagagccaccgcctgttaaaatagcctggaaaactgcggcagcaaggaaatccttacca
gcttccattacgatgcacaaagggagcctggatttgcagaagtgtaacatgtctccagtt
gtgaaaattgaacaagtgtttgctcttcagaatgctacaggggatgggaaatttatcgat
caatttgtttattcaacaaagggaattggtaacaaaacagaaataagtgtcagggggcaa
gacaggcttataatttctacaccaaaccagagaaatgaaaagccaacgcagagtgtatca
tctcctgaagcaacatctggttctacaggctcagtagaaaagaagcaacagagaagatca
attagaactcgttctgaatcagagaaatccactgaggttgtgccaaagaagaagatcaaa
aaggagcaggttgaaacagttcctcaggctacagtgaagactggattacagaaaggtgcc
agcgagatttcagattcctgtaaacctctaaagaaaaggagtcgcgcctcaactgatgta
gaaatgactagttcagcatacagagacacatctgactccgattctagaggactgagtgac
ctgcaggtaggctttggaaagcaagtagatagcccttcagctactgcagatgcagacgtt
tctgatgtgcagtccatggattcaagtttgtcgagaagaggcactggaatgagtaagaag
gacactgtatgtcagatttgtgaaagctctggtgactctctgattccttgtgagggagag
tgctgcaaacactttcacctggagtgcctgggattggcatcacttcctgatagcaagttc
atctgcatggaatgtaaaactgggcagcacccatgtttttcgtgtaaagtgtctggtaaa
gatgtgaagcgttgttctgttggtgcttgtgggaaattttatcatgaagcctgtgtccgc
aaattccccactgccatctttgaatcaaaaggattccgctgtcctcagcactgctgctct
gcctgctctatggagaaagatatccacaaagcaagtaaaggccgcatgatgagatgttta
agatgtccagttgcctatcactctggagatgcttgcattgcggccggaagcatgttagta
tcctcctacattctcatctgtagtaatcattccaaacggagcagtaattcttctgctgta
aatgtaggcttttgtttcgtttgtgccagagggctgatagttcaggaccattcagacccc
atgttcagttcatatgcctataagtcccactacctactgaatgaatcaaatcgtgctgag
ttgatgaaattacctatgattccttcttcgtcagcttccaaaaagaaatgtgagaaaggt
ggaagattgctctgctgtgaatcgtgcccagcttccttccacccggaatgcctaagcata
gaaatgccagaaggctgctggaattgtaatgactgtaaagctggcaagaaactacattac
aagcagattgtttgggtcaaattgggaaattacagatggtggccagcagagatctgcaac
cccaggtctgtgccactgaacatccagggccttaaacatgacttgggggacttccctgta
ttcttctttggttctcatgactactactgggtacaccagggcagagtgttcccttatgtt
gaaggagacaaaagctttgctgaagggcagactagtattaacaagaccttcaaaaaggca
ctggaagaagctgcaaaacgtttccaggaattgaaagcacaaagagaaagtaaagaagcc
ctagagattgaaaaaaactcaagaaaaccccctccctacaaacacatcaaagctaacaaa
gtaataggaaaggtgcagatccaggttgctgacctgtcagagattccccgctgtaactgc
aagccagctgatgaaaacccttgtggcttggaatcggagtgcctgaacagaatgttgcag
tatgaatgccacccgcaggtgtgcccagctggagatcgttgtcagaaccagtgctttaca
aagagactataccctgatgcagagatcatcaaaacggagcggagaggctggggcctcagg
accaaaaggagcattaagaagggtgaatttgtaaatgaatacgtcggtgaattaattgat
gaagaagaatgcagattgcgaatcaagcgagcccacgagaacagtgtaactaatttttat
atgttaactgttaccaaggaccgtataattgatgccggcccaaaaggaaattattctcgc
ttcatgaaccacagttgtaatcccaactgtgaaacacaaaagtggacagtgaatggagat
gttcgagtgggactatttgctctctgtgatattcctgcagggatggagttaacatttaat
tataacctagattgtctgggcaacggcagaacggagtgccactgtggagcagataactgc
agtggttttctaggagtgcggccaaagtcggcatgtgcgtcaacaaatgaagagaaggca
aaaaatgctaagttaaaacagaagagacgaaagatcaaaacagaaccaaagcagatgcat
gaagattactgttttcaatgtggagatggtggagagctggtcatgtgtgacaaaaaagac
tgtcccaaagcataccacctcctatgccttaacctgactcagccaccatatggaaagtgg
gagtgtccgtggcatcagtgcgatgagtgcagcagtgcagctgtttccttctgtgaattc
tgtccacattcattttgtaaagatcatgaaaagggggccctggttccctctgcactggaa
ggccgcctctgctgctcggaacatgaccccatggctcctgtgtcaccagaatactggagc
aagataaaatgtaaatgggaatcacaagatcatggagaagaagtaaaagaataa

DBGET integrated database retrieval system