KEGG   Homo sapiens (human): 54988
Entry
54988             CDS       T01001                                 
Symbol
ACSM5
Name
(RefSeq) acyl-CoA synthetase medium chain family member 5
  KO
K01896  medium-chain acyl-CoA synthetase [EC:6.2.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00650  Butanoate metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    54988 (ACSM5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    54988 (ACSM5)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.2  medium-chain acyl-CoA ligase
     54988 (ACSM5)
Lipid biosynthesis proteins [BR:hsa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   54988 (ACSM5)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 54988
NCBI-ProteinID: NP_001311300
OMIM: 614361
HGNC: 26060
Ensembl: ENSG00000183549
Pharos: Q6NUN0(Tdark)
UniProt: Q6NUN0
Position
16:20409534..20441336
AA seq 579 aa
MRPWLRHLVLQALRNSRAFCGSHGKPAPLPVPQKIVATWEAISLGRQLVPEYFNFAHDVL
DVWSRLEEAGHRPPNPAFWWVNGTGAEIKWSFEELGKQSRKAANVLGGACGLQPGDRMML
VLPRLPEWWLVSVACMRTGTVMIPGVTQLTEKDLKYRLQASRAKSIITSDSLAPRVDAIS
AECPSLQTKLLVSDSSRPGWLNFRELLREASTEHNCMRTKSRDPLAIYFTSGTTGAPKMV
EHSQSSYGLGFVASGRRWVALTESDIFWNTTDTGWVKAAWTLFSAWPNGSCIFVHELPRV
DAKVILNTLSKFPITTLCCVPTIFRLLVQEDLTRYQFQSLRHCLTGGEALNPDVREKWKH
QTGVELYEGYGQSETVVICANPKGMKIKSGSMGKASPPYDVQIVDDEGNVLPPGEEGNVA
VRIRPTRPFCFFNCYLDNPEKTAASEQGDFYITGDRARMDKDGYFWFMGRNDDVINSSSY
RIGPVEVESALAEHPAVLESAVVSSPDPIRGEVVKAFIVLTPAYSSHDPEALTRELQEHV
KRVTAPYKYPRKVAFVSELPKTVSGKIQRSKLRSQEWGK
NT seq 1740 nt   +upstreamnt  +downstreamnt
atgagaccatggctgagacacctagtcctccaggcactgaggaactccagggcattctgt
gggtctcatgggaagccagcacctctacctgttcctcagaagatcgtggccacctgggaa
gccatcagcctgggaaggcagctggtgcctgagtacttcaacttcgcccatgatgtgctg
gatgtgtggagtcggctggaagaggctggacaccgccccccaaatcctgccttctggtgg
gtcaatggcacaggagcagagatcaagtggagctttgaggagctggggaagcagtccagg
aaggcagccaatgtgctggggggtgcatgcggcctgcagcctggggacagaatgatgctg
gtactcccacggctcccggagtggtggctggtcagtgtggcttgcatgcggacagggact
gtgatgattccgggtgtgactcagctgacagagaaggacctcaagtaccggctgcaggcg
tccagggccaagtccattatcaccagtgactccctagctccaagggtggatgccatcagt
gccgaatgcccctccctccagaccaagctgctggtgtcagacagcagtcggccaggctgg
ttgaacttcagggaactcctccgggaggcttctacagagcacaactgcatgaggacaaag
agtcgagacccgctggccatctactttaccagcggaaccaccggggcccccaagatggtc
gagcactcccagagcagctacggactgggttttgtggccagcggaagacggtgggtggcc
ttgaccgaatctgacatcttctggaacacgactgacactggctgggtgaaggcagcctgg
actctcttctctgcctggcctaatggatcttgcatttttgtgcatgagctgccccgagtt
gatgccaaagttatcctgaatactctctccaaattcccgataaccaccctctgctgtgtc
ccaaccatctttcggctgcttgtgcaggaggatctgaccaggtaccagtttcagagcctg
aggcactgtctgaccggaggagaggccctcaaccctgacgtgagggagaagtggaaacac
cagactggtgtggagctgtacgaaggctatggccagtctgaaacggttgtcatctgtgcc
aatccaaaaggcatgaaaatcaagtctggatccatggggaaggcgtccccaccctacgat
gtgcagattgtggatgatgagggcaacgtcctgcctcctggagaagaggggaatgttgcc
gtccgtatcagacccactcggcccttctgtttcttcaattgctatttggacaatcctgag
aagacagctgcatcagaacaaggggacttttacatcacaggggaccgagctcgcatggac
aaggatggctacttttggttcatgggaagaaacgacgatgtgatcaattcttcaagctac
cggatcgggcctgttgaagtggaaagtgccctggcagagcatcctgctgtcctggagtcg
gctgtggtcagcagcccagaccccatcaggggagaggtggtaaaggcatttatagtcctt
actccagcctactcctctcatgacccagaggcactaacgcgggaactccaggagcatgtg
aaaagggtgactgctccatacaaataccccaggaaggtggcctttgtttcagaactgcca
aagacggtttctggaaagatccaaaggagtaaattgcgaagtcaggagtgggggaaatga

DBGET integrated database retrieval system