KEGG   Homo sapiens (human): 54993
Entry
54993             CDS       T01001                                 
Symbol
ZSCAN2, ZFP29, ZNF854
Name
(RefSeq) zinc finger and SCAN domain containing 2
  KO
K09230  SCAN domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    54993 (ZSCAN2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    54993 (ZSCAN2)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz SCAN Zn-ribbon_8 zf_UBZ C1_4 Zn_ribbon_SprT zf-met zf-Di19 HVO_2753_ZBP
Other DBs
NCBI-GeneID: 54993
NCBI-ProteinID: NP_870992
HGNC: 20994
Ensembl: ENSG00000176371
UniProt: Q7Z7L9
Position
15:84601009..84623716
AA seq 614 aa
MMAADIPRVTTPLSSLVQVPQEEDRQEEEVTTMILEDDSWVQEAVLQEDGPESEPFPQSA
GKGGPQEEVTRGPQGALGRLRELCRRWLRPEVHTKEQMLTMLPKEIQAWLQEHRPESSEE
AAALVEDLTQTLQDSDFEIQSENGENCNQDMFENESRKIFSEMPEGESAQHSDGESDFER
DAGIQRLQGHSPGEDHGEVVSQDREVGQLIGLQGTYLGEKPYECPQCGKTFSRKSHLITH
ERTHTGEKYYKCDECGKSFSDGSNFSRHQTTHTGEKPYKCRDCGKSFSRSANLITHQRIH
TGEKPFQCAECGKSFSRSPNLIAHQRTHTGEKPYSCPECGKSFGNRSSLNTHQGIHTGEK
PYECKECGESFSYNSNLIRHQRIHTGEKPYKCTDCGQRFSQSSALITHRRTHTGEKPYQC
SECGKSFSRSSNLATHRRTHMVEKPYKCGVCGKSFSQSSSLIAHQGMHTGEKPYECLTCG
ESFSWSSNLLKHQRIHTGEKPYKCSECGKCFSQRSQLVVHQRTHTGEKPYKCLMCGKSFS
RGSILVMHQRAHLGDKPYRCPECGKGFSWNSVLIIHQRIHTGEKPYKCPECGKGFSNSSN
FITHQRTHMKEKLY
NT seq 1845 nt   +upstreamnt  +downstreamnt
atgatggctgcagacatcccgagagtgaccactccgctgagctccttggtccaggtgcct
caagaggaagatagacaggaggaggaggtcaccaccatgatcctggaggatgactcctgg
gtgcaagaagctgtgctgcaggaggatggccctgagtctgagccctttccccagagtgct
ggcaagggcggcccccaggaggaggtgaccaggggaccacagggtgcactcggccgcctc
cgagagctctgccggcgctggctgagaccagaggtacacaccaaggagcagatgttaacc
atgctgccaaaggaaattcaggcttggctgcaagagcatcggcctgaaagcagtgaggag
gcagcggccctggtggaagacttgacccagacccttcaggacagtgattttgagatacag
agtgaaaatggggagaactgtaatcaagacatgtttgagaatgaatcacgtaagatattc
tcggaaatgcctgaaggtgaaagtgctcagcactccgatggggaaagtgactttgagaga
gatgctggcatccagaggctccagggacacagcccaggtgaggaccacggggaggtggtt
tctcaggacagggaagttggccagctcataggcctgcagggcacctacctaggggagaag
ccctacgaatgtccccagtgtgggaagaccttcagccggaaatcccacctcatcacacac
gagaggacccacacaggagagaaatactacaaatgtgatgaatgtggaaaaagctttagt
gatggttcaaattttagtagacaccaaaccactcacaccggggagaagccctacaaatgc
agagactgtgggaagagctttagccggagtgccaacctcataacccaccagaggatccac
acgggggaaaagcccttccagtgtgccgagtgtggcaagagcttcagcaggagtcccaac
ctcattgcacatcagcgcacccacacaggagagaaaccctactcgtgccccgagtgtgga
aagagctttggcaaccgatccagccttaacacgcatcaggggatccacactggagaaaag
ccctacgaatgtaaagaatgcggcgaaagctttagttacaactccaatctaatcagacac
cagagaatccacacaggagagaaaccctacaaatgtaccgactgtgggcagaggttcagc
cagagttcagccctcatcacccaccggagaacccacacaggagagaaaccctaccagtgc
agcgagtgtgggaaaagcttcagccgcagctctaacctggccacacaccggagaacccac
atggtggagaagccctataagtgtggggtgtgtgggaagagcttcagccagagctccagt
ctgattgcacaccagggcatgcacacaggggagaaaccctacgagtgcctgacatgtggg
gagagcttcagctggagctccaacctcctcaagcaccagaggatccacacgggagagaaa
ccctacaaatgcagcgagtgtgggaaatgcttcagccagcgctcccagctcgtagtgcac
cagcggacccacacgggcgagaagccctacaaatgcctcatgtgcggcaagagcttcagc
cggggctccattctggtcatgcaccagagagcccatttgggagacaagccctacaggtgc
cctgagtgtgggaaaggctttagctggaactcagtcctcattatacatcagcgaatccac
actggggagaagccctacaaatgccccgagtgtggcaaaggcttcagcaacagctctaac
tttatcacacatcagagaactcacatgaaagagaaactttattga

DBGET integrated database retrieval system