KEGG   Homo sapiens (human): 55002
Entry
55002             CDS       T01001                                 
Symbol
TMCO3, C13orf11
Name
(RefSeq) transmembrane and coiled-coil domains 3
  KO
K26735  K+:H+ antiporter
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    55002 (TMCO3)
Transporters [BR:hsa02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   55002 (TMCO3)
SSDB
Motif
Pfam: Na_H_Exchanger DUF16
Other DBs
NCBI-GeneID: 55002
NCBI-ProteinID: NP_060375
OMIM: 617134
HGNC: 20329
Ensembl: ENSG00000150403
UniProt: Q6UWJ1 A0A024RE09
Position
13:113491021..113550229
AA seq 677 aa
MKVLGRSFFWVLFPVLPWAVQAVEHEEVAQRVIKLHRGRGVAAMQSRQWVRDSCRKLSGL
LRQKNAVLNKLKTAIGAVEKDVGLSDEEKLFQVHTFEIFQKELNESENSVFQAVYGLQRA
LQGDYKDVVNMKESSRQRLEALREAAIKEETEYMELLAAEKHQVEALKNMQHQNQSLSML
DEILEDVRKAADRLEEEIEEHAFDDNKSVKGVNFEAVLRVEEEEANSKQNITKREVEDDL
GLSMLIDSQNNQYILTKPRDSTIPRADHHFIKDIVTIGMLSLPCGWLCTAIGLPTMFGYI
ICGVLLGPSGLNSIKSIVQVETLGEFGVFFTLFLVGLEFSPEKLRKVWKISLQGPCYMTL
LMIAFGLLWGHLLRIKPTQSVFISTCLSLSSTPLVSRFLMGSARGDKEGDIDYSTVLLGM
LVTQDVQLGLFMAVMPTLIQAGASASSSIVVEVLRILVLIGQILFSLAAVFLLCLVIKKY
LIGPYYRKLHMESKGNKEILILGISAFIFLMLTVTELLDVSMELGCFLAGALVSSQGPVV
TEEIATSIEPIRDFLAIVFFASIGLHVFPTFVAYELTVLVFLTLSVVVMKFLLAALVLSL
ILPRSSQYIKWIVSAGLAQVSEFSFVLGSRARRAGVISREVYLLILSVTTLSLLLAPVLW
RAAITRCVPRPERRSSL
NT seq 2034 nt   +upstreamnt  +downstreamnt
atgaaggtgttgggaagaagcttcttctgggtgctgtttcccgtccttccctgggcggtg
caggctgtggagcacgaggaggtggcgcagcgtgtgatcaaactgcaccgcgggcgaggg
gtggctgccatgcagagccggcagtgggtccgggacagctgcaggaagctctcagggctt
ctccgccagaagaatgcagttctgaacaaactgaaaactgcaattggagcagtggagaaa
gacgtgggcctgtcggatgaagagaaactgtttcaggtgcacacgtttgaaattttccag
aaagagctgaatgaaagtgaaaattccgttttccaagctgtctacggactgcagagagcc
ctgcagggggattacaaagatgtcgtgaacatgaaggagagcagccggcagcgcctggag
gccctgagagaggctgcaataaaggaagaaacagaatatatggaacttctggcagcagaa
aaacatcaagttgaagcccttaaaaatatgcaacatcaaaaccaaagtttatccatgctt
gacgagattcttgaagatgtaagaaaggcagcggatcgtctggaggaagagatagaggaa
catgcttttgacgacaataaatcagtcaagggggtcaattttgaggcagttctgagggtg
gaggaagaagaggccaattctaagcaaaatataacaaaacgagaagtggaggatgacttg
ggtcttagcatgctgattgactcccagaacaaccagtatattttgaccaagcccagagat
tcaaccatcccacgtgcagatcaccactttataaaggacattgttaccataggaatgctg
tccttgccttgtggctggctatgtacagccataggattgcctacaatgtttggttatatt
atttgtggtgtacttctgggaccttcaggactaaatagtattaagtctattgtgcaagtg
gagacattaggagaatttggggtgttttttactctttttcttgttggcttagaattttct
ccagaaaagctaagaaaggtgtggaagatttccttacaagggccgtgttacatgacactg
ttaatgattgcatttggcttgctgtgggggcatctcttgcggatcaaacccacgcagagc
gtcttcatttccacgtgtctgtccttgtcaagcacacccctcgtgtccaggttcctcatg
ggcagtgctcggggtgacaaagaaggcgacattgactacagcaccgtgctcctcggcatg
ctggtgacgcaggacgtgcagctcgggctcttcatggccgtcatgccgactctcatacag
gcgggcgccagtgcatcttctagcattgtcgtggaagttctccgaatcctggttttgatt
ggtcagattcttttttcactagcggcggtttttcttttatgtcttgttataaagaagtat
ctcattggaccctattatcggaagctgcacatggaaagcaaggggaacaaagaaatcctg
atcttgggaatatctgcctttatcttcttaatgttaacggtcacggagctgctggacgtc
tccatggagctgggctgtttcctggctggagcgctcgtctcctctcagggccccgtggtc
accgaggagatcgccacctccatcgaacccatccgcgacttcctggccatcgttttcttc
gcctccatagggctccacgtgttccccacgtttgtggcgtacgagctcacggtgctggtg
ttcctcaccttgtcagtggtggtgatgaagtttctcctggcggcgctggtcctgtctctc
attctgccgaggagcagccagtacatcaagtggatcgtctctgcggggcttgcccaggtc
agcgagttttcctttgtcctggggagccgggcgcgaagagcgggcgtcatctctcgggag
gtgtacctccttatactgagtgtgaccacgctcagcctcttgctcgccccggtgctgtgg
agagctgcaatcacgaggtgtgtgcccagaccggagagacggtccagcctctga

DBGET integrated database retrieval system