KEGG   Homo sapiens (human): 55223
Entry
55223             CDS       T01001                                 
Symbol
TRIM62, DEAR1
Name
(RefSeq) tripartite motif containing 62
  KO
K12030  tripartite motif-containing protein 62 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    55223 (TRIM62)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     55223 (TRIM62)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    55223 (TRIM62)
SSDB
Motif
Pfam: SPRY PRY zf-C3HC4_4 zf-RING_UBOX zf-C3HC4 zf-B_box zf-C3HC4_2 zf-RING_2 zf-C3HC4_3 zf-RING_6 zf-RING_5 GlgE_dom_N_S zf-RING_10 zf-ANAPC11 KxDL Ribosomal_L37ae U-box AAA_13 DUF2383 zf-Nse Fib_alpha Phasin TMEM191C CorA Prominin DUF2884 OmpH CCDC93_CC DUF4559 DUF4795 Vps39_1 Uso1_p115_C Spc24
Other DBs
NCBI-GeneID: 55223
NCBI-ProteinID: NP_060677
OMIM: 616755
HGNC: 25574
Ensembl: ENSG00000116525
UniProt: Q9BVG3
Position
1:complement(33145399..33182043)
AA seq 475 aa
MACSLKDELLCSICLSIYQDPVSLGCEHYFCRRCITEHWVRQEAQGARDCPECRRTFAEP
ALAPSLKLANIVERYSSFPLDAILNARRAARPCQAHDKVKLFCLTDRALLCFFCDEPALH
EQHQVTGIDDAFDELQRELKDQLQALQDSEREHTEALQLLKRQLAETKSSTKSLRTTIGE
AFERLHRLLRERQKAMLEELEADTARTLTDIEQKVQRYSQQLRKVQEGAQILQERLAETD
RHTFLAGVASLSERLKGKIHETNLTYEDFPTSKYTGPLQYTIWKSLFQDIHPVPAALTLD
PGTAHQRLILSDDCTIVAYGNLHPQPLQDSPKRFDVEVSVLGSEAFSSGVHYWEVVVAEK
TQWVIGLAHEAASRKGSIQIQPSRGFYCIVMHDGNQYSACTEPWTRLNVRDKLDKVGVFL
DYDQGLLIFYNADDMSWLYTFREKFPGKLCSYFSPGQSHANGKNVQPLRINTVRI
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggcgtgcagcctcaaggacgagctgctgtgctccatctgcctgagcatctaccaggac
ccggtgagcctgggctgcgagcattacttctgccgccgctgcatcacggagcactgggtg
cggcaggaggcgcagggcgcccgcgactgccccgagtgccggcgcacgttcgccgagccc
gcgctggcgcccagcctcaagctggccaacatcgtggagcgctacagctccttcccgctg
gacgccatcctcaacgcgcgccgcgccgcgcgaccctgccaggcgcacgacaaggtcaag
ctcttctgcctcacggaccgcgcgcttctctgcttcttctgcgacgagcctgcactgcac
gagcagcatcaggtcaccggcatcgacgacgccttcgacgagctgcagagggagctgaag
gaccaacttcaggcccttcaagacagcgagcgggaacacaccgaagcgctgcagctgctc
aagcgacaactggcggagaccaagtcttccaccaagagcctgcggaccactatcggcgag
gccttcgagcggctgcaccggctgctgcgtgaacgccagaaggccatgctagaggagctg
gaggcggacacggcccgcacgctgaccgacatcgagcagaaagtccagcgctacagccag
cagctgcgcaaggtccaggagggagcccagatcctgcaggagcggctggctgaaaccgac
cggcacaccttcctggctggggtggcctcactgtccgagcggctcaagggaaaaatccat
gagaccaacctcacatatgaagacttcccgacctccaagtacacaggccccctgcagtac
accatctggaagtccctgttccaggacatccacccagtgccagccgccctaaccctggac
ccgggcacagcccaccagcgcctgatcctgtcggacgactgcaccattgtggcttacggc
aacttgcacccacagccactgcaggactcgccaaagcgcttcgatgtggaggtgtcggtg
ctgggttctgaagccttcagtagtggcgtccactactgggaggtggtggtggcggagaag
acccagtgggtgatcgggctggcacacgaagccgcaagccgcaagggcagcatccagatc
cagcccagccgcggcttctactgcatcgtgatgcacgatggcaaccagtacagcgcctgc
acggagccctggacgcggcttaacgtccgggacaagcttgacaaggtgggtgtcttcctg
gactatgaccaaggcttgctcatcttctacaatgctgatgacatgtcctggctctacacc
ttccgcgagaagttccctggcaagctctgctcttacttcagccctggccagagccacgcc
aatggcaagaacgttcagccgctgcggatcaacaccgtccgcatctag

DBGET integrated database retrieval system