KEGG   Homo sapiens (human): 55801Help
Entry
55801             CDS       T01001                                 

Gene name
IL26, AK155, IL-26
Definition
(RefSeq) interleukin 26
  KO
K05446  interleukin 26
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    55801 (IL26)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    55801 (IL26)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   55801 (IL26)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL10 IL22 RPN6_C_helix PRP9_N
Motif
Other DBs
NCBI-GeneID: 55801
NCBI-ProteinID: NP_060872
OMIM: 605679
HGNC: 17119
Ensembl: ENSG00000111536
Vega: OTTHUMG00000169114
Pharos: Q9NPH9(Tbio)
UniProt: Q9NPH9
Position
12q15
AA seq 171 aa AA seqDB search
MLVNFILRCGLLLVTLSLAIAKHKQSSFTKSCYPRGTLSQAVDALYIKAAWLKATIPEDR
IKNIRLLKKKTKKQFMKNCQFQEQLLSFFMEDVFGQLQLQGCKKIRFVEDFHSLRQKLSH
CISCASSAREMKSITRMKRIFYRIGNKGIYKAISELDILLSWIKKLLESSQ
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgctggtgaatttcattttgaggtgtgggttgctgttagtcactctgtctcttgccatt
gccaagcacaagcaatcttccttcaccaaaagttgttacccaaggggaacattgtcccaa
gctgttgacgctctctatatcaaagcagcatggctcaaagcaacgattccagaagaccgc
ataaaaaatatacgattattaaaaaagaaaacaaaaaagcagtttatgaaaaactgtcaa
tttcaagaacagcttctgtccttcttcatggaagacgtttttggtcaactgcaattgcaa
ggctgcaagaaaatacgctttgtggaggactttcatagccttaggcagaaattgagccac
tgtatttcctgtgcttcatcagctagagagatgaaatccattaccaggatgaaaagaata
ttttataggattggaaacaaaggaatctacaaagccatcagtgaactggatattcttctt
tcctggattaaaaaattattggaaagcagtcagtaa

DBGET integrated database retrieval system