KEGG   Homo sapiens (human): 55905
Entry
55905             CDS       T01001                                 
Symbol
RNF114, PSORS12, ZNF313
Name
(RefSeq) ring finger protein 114
  KO
K15697  E3 ubiquitin-protein ligase RNF114 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    55905 (RNF114)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     55905 (RNF114)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    55905 (RNF114)
SSDB
Motif
Pfam: zf-Di19 zf_C2HC_14 zf-RING_UBOX zf-C3HC4 zf-C3HC4_3 zf-C3HC4_2 zf-RING_2 zf-RING_5 zf-C3HC4_4 zf-RING_6 Prok-RING_4 U-box DND1_DSRM zf-C2H2_12 zf-C2H2_4
Other DBs
NCBI-GeneID: 55905
NCBI-ProteinID: NP_061153
OMIM: 612451
HGNC: 13094
Ensembl: ENSG00000124226
Pharos: Q9Y508(Tbio)
UniProt: Q9Y508
Position
20:49936397..49953885
AA seq 228 aa
MAAQQRDCGGAAQLAGPAAEADPLGRFTCPVCLEVYEKPVQVPCGHVFCSACLQECLKPK
KPVCGVCRSALAPGVRAVELERQIESTETSCHGCRKNFFLSKIRSHVATCSKYQNYIMEG
VKATIKDASLQPRNVPNRYTFPCPYCPEKNFDQEGLVEHCKLFHSTDTKSVVCPICASMP
WGDPNYRSANFREHIQRRHRFSYDTFVDYDVDEEDMMNQVLQRSIIDQ
NT seq 687 nt   +upstreamnt  +downstreamnt
atggcggcgcaacagcgggactgcgggggtgctgcgcagctggcggggccggcggcggag
gctgaccccctaggacgcttcacgtgtcccgtgtgcttagaggtgtacgagaagccggta
caggtgccctgcggacacgtcttttgctctgcatgcctgcaggaatgtctgaagccgaag
aagcctgtctgtggggtgtgtcgcagcgctctggcacctggcgtccgagccgtggagctc
gagcggcagatcgagagcacagagacttcttgccatggctgccgtaagaatttcttcctg
tccaagatccggtcccacgtggctacttgttccaaataccagaattacatcatggaaggt
gtgaaggccaccattaaggatgcatctcttcagccaaggaatgttccaaaccgttacacc
tttccttgtccttactgtcctgagaagaactttgatcaggaaggacttgtggaacactgc
aaattattccatagcacggataccaaatctgtggtttgtccgatatgtgcctcgatgccc
tggggagaccccaactaccgcagcgccaacttcagagagcacatccagcgccggcaccgg
ttttcttatgacacttttgtggattatgatgttgatgaagaggacatgatgaatcaggtg
ttgcagcgctccatcatcgaccagtga

DBGET integrated database retrieval system