KEGG   Homo sapiens (human): 5592Help
Entry
5592              CDS       T01001                                 

Gene name
PRKG1, AAT8, PKG, PKG1, PRKG1B, PRKGR1B, cGK, cGK_1, cGK1, cGKI, cGKI-BETA, cGKI-alpha
Definition
(RefSeq) protein kinase cGMP-dependent 1
  KO
K07376  cGMP-dependent protein kinase 1 [EC:2.7.11.12]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04713  Circadian entrainment
hsa04714  Thermogenesis
hsa04730  Long-term depression
hsa04740  Olfactory transduction
hsa04923  Regulation of lipolysis in adipocytes
hsa04970  Salivary secretion
Module
hsa_M00694  cGMP signaling
Disease
H00801  Familial thoracic aortic aneurysm and dissection (TAAD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP - PKG signaling pathway
    5592 (PRKG1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    5592 (PRKG1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    5592 (PRKG1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    5592 (PRKG1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    5592 (PRKG1)
  09154 Digestive system
   04970 Salivary secretion
    5592 (PRKG1)
  09156 Nervous system
   04730 Long-term depression
    5592 (PRKG1)
  09157 Sensory system
   04740 Olfactory transduction
    5592 (PRKG1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    5592 (PRKG1)
   04714 Thermogenesis
    5592 (PRKG1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5592 (PRKG1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     5592 (PRKG1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  PKG family
   5592 (PRKG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase cNMP_binding Pkinase_Tyr PKcGMP_CC Kinase-like Wtap APH Pkinase_C Atg14 Tnp_22_trimer Med4 OmpH IncA
Motif
Other DBs
NCBI-GeneID: 5592
NCBI-ProteinID: NP_001091982
OMIM: 176894
HGNC: 9414
Ensembl: ENSG00000185532
Vega: OTTHUMG00000018248
Pharos: Q13976(Tchem)
UniProt: Q13976
Structure
PDB: 

Position
10q11.23-q21.1
AA seq 671 aa AA seqDB search
MSELEEDFAKILMLKEERIKELEKRLSEKEEEIQELKRKLHKCQSVLPVPSTHIGPRTTR
AQGISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMY
PVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTAT
VKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEET
HYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDV
RTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSDF
NIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDF
IVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGI
IYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISAD
YWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPS
ERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPP
PDDNSGWDIDF
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagctagaggaagactttgccaagattctcatgctcaaggaggagaggatcaaa
gagctggagaagcggctgtcagagaaggaggaagaaattcaggagctgaagaggaaactc
cacaaatgccagtcggtgctcccagtgccctcgacccacatcggcccccggaccacccgg
gcgcagggcatctcggccgagccgcagacgtacaggtccttccacgacctccgacaggca
ttccggaagttcaccaagtccgaaaggtccaaggatcttataaaggaagctatccttgac
aatgactttatgaagaacttggagctgtcgcagatccaggagattgtggattgtatgtac
ccggtggagtatggcaaggacagttgcatcatcaaagaaggagacgtggggtcactggtg
tatgtcatggaagatggtaaggttgaagttacaaaagaaggtgtgaagttgtgtaccatg
ggtccaggaaaagtgtttggggaattggctattctttacaactgtacccggacagcgacc
gtcaagactcttgtaaatgtaaaactctgggccattgatcgacaatgttttcaaacaata
atgatgaggacaggactcatcaagcataccgagtatatggaatttttaaaaagcgttcca
acattccagagccttcctgaagagatcctcagcaagcttgctgatgtccttgaagagacc
cactatgaaaatggagaatatattatcaggcaaggtgcaagaggggacaccttctttatc
atcagcaaaggaacggtaaatgtcactcgtgaagactcaccgagtgaagacccagtcttt
cttagaactttaggaaaaggagactggtttggagagaaagccttgcagggggaagatgtg
agaacagcaaacgtaattgctgcagaagctgtaacctgccttgtgattgacagagactct
tttaaacatttgattggagggctggatgatgtttctaataaagcatatgaagatgcagaa
gctaaagcaaaatatgaagctgaagcggctttcttcgccaacctgaagctgtctgatttc
aacatcattgatacccttggagttggaggtttcggacgagtagaactggtccagttgaaa
agtgaagaatccaaaacgtttgcaatgaagattctcaagaaacgtcacattgtggacaca
agacagcaggagcacatccgctcagagaagcagatcatgcagggggctcattccgatttc
atagtgagactgtacagaacatttaaggacagcaaatatttgtatatgttgatggaagct
tgtctaggtggagagctctggaccattctcagggatagaggttcgtttgaagattctaca
accagattttacacagcatgtgtggtagaagcttttgcctatctgcattccaaaggaatc
atttacagggacctcaagccagaaaatctcatcctagatcaccgaggttatgccaaactg
gttgattttggctttgcaaagaaaataggatttggaaagaaaacatggactttttgtggg
actccagagtatgtagccccagagatcatcctgaacaaaggccatgacatttcagccgac
tactggtcactgggaatcctaatgtatgaactcctgactggcagcccacctttctcaggc
ccagatcctatgaaaacctataacatcatattgagggggattgacatgatagaatttcca
aagaagattgccaaaaatgctgctaatttaattaaaaaactatgcagggacaatccatca
gaaagattagggaatttgaaaaatggagtaaaagacattcaaaagcacaaatggtttgag
ggctttaactgggaaggcttaagaaaaggtaccttgacacctcctataataccaagtgtt
gcatcacccacagacacaagtaattttgacagtttccctgaggacaacgatgaaccacca
cctgatgacaactcaggatgggatatagacttctaa

DBGET integrated database retrieval system