KEGG   Homo sapiens (human): 55972
Entry
55972             CDS       T01001                                 

Gene name
SLC25A40, MCFP
Definition
(RefSeq) solute carrier family 25 member 40
  KO
K15119  solute carrier family 25, member 39/40
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    55972 (SLC25A40)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   55972 (SLC25A40)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 55972
NCBI-ProteinID: NP_061331
OMIM: 610821
HGNC: 29680
Ensembl: ENSG00000075303
Vega: OTTHUMG00000131033
Pharos: Q8TBP6(Tdark)
UniProt: Q8TBP6
Position
7q21.12
AA seq 338 aa
MDPETRGQEIIKVTPLQQMLASCTGAILTSVIVTPLDVVKIRLQAQNNPLPKGKCFVYSN
GLMDHLCVCEEGGNKLWYKKPGNFQGTLDAFFKIIRNEGIKSLWSGLPPTLVMAVPATVI
YFTCYDQLSALLRSKLGENETCIPIVAGIVARFGAVTVISPLELIRTKMQSKKFSYVELH
RFVSKKVSEDGWISLWRGWAPTVLRDVPFSAMYWYNYEILKKWLCEKSGLYEPTFMINFT
SGALSGSFAAVATLPFDVVKTQKQTQLWTYESHKISMPLHMSTWIIMKNIVAKNGFSGLF
SGLIPRLIKIAPACAIMISTYEFGKAFFQKQNVRRQQY
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggatcctgagacaaggggacaagagattatcaaagtgacacctcttcaacaaatgctt
gcctcatgtactggagctatactgacatcagtaatagtgacacccctggatgttgttaaa
attagactccaagcccaaaacaacccactccccaaaggaaaatgttttgtatatagtaat
ggactcatggatcatctatgtgtctgtgaagagggaggcaacaaactatggtataagaag
ccaggaaatttccagggaacattggatgcattttttaaaatcattcgaaatgagggcatt
aaatctctatggagtggccttcctcctaccctagtgatggcagttcctgccacagttatt
tattttacctgctatgatcaattaagtgctcttctgagatctaagttaggagaaaatgaa
acctgcataccaattgttgctggaattgtagccagatttggtgcagtaactgtgataagt
ccactagaattgattagaaccaagatgcagtccaagaagttttcttacgtggaactgcat
cgatttgtcagcaagaaagtatctgaagatggttggatttccctttggaggggctgggct
cctactgttcttagagatgtacctttctcagcaatgtactggtataactatgaaatttta
aagaagtggttatgtgagaaatctggtttatatgagccaacatttatgatcaactttact
tcaggggcattgtctggttcttttgctgctgttgcaactttaccatttgatgtagtaaaa
acacaaaagcagacacaactttggacatatgaaagtcataaaatttctatgcctttgcat
atgtcaacctggattataatgaagaacattgttgctaaaaatggattttccggattattt
tcaggcctaattcctcgcttaattaaaattgctcctgcttgtgccattatgatcagtaca
tatgaatttggaaaggcttttttccagaaacaaaatgttcgaaggcagcaatactag

DBGET integrated database retrieval system