KEGG   Homo sapiens (human): 55997
Entry
55997             CDS       T01001                                 

Gene name
CFC1, CFC1B, CRYPTIC, DTGA2, HTX2
Definition
(RefSeq) cripto, FRL-1, cryptic family 1
Organism
hsa  Homo sapiens (human)
Disease
H00550  Complete transposition of the great arteries
H00632  Heterotaxy
H00918  Double-outlet right ventricle
SSDB
Motif
Pfam: CFC EGF_2 hEGF EGF
Other DBs
NCBI-GeneID: 55997
NCBI-ProteinID: NP_115934
OMIM: 605194
HGNC: 18292
Ensembl: ENSG00000136698
Vega: OTTHUMG00000131628
Pharos: P0CG37(Tbio)
UniProt: P0CG37
Position
2q21.1
AA seq 223 aa
MTWRHHVRLLFTVSLALQIINLGNSYQREKHNGGREEVTKVATQKHRQSPLNWTSSHFGE
VTGSAEGWGPEEPLPYSRAFGEGASARPRCCRNGGTCVLGSFCVCPAHFTGRYCEHDQRR
SECGALEHGAWTLRACHLCRCIFGALHCLPLQTPDRCDPKDFLASHAHGPSAGGAPSLLL
LLPCALLHRLLRPDAPAHPRSLVPSVLQRERRPCGRPGLGHRL
NT seq 672 nt   +upstreamnt  +downstreamnt
atgacctggaggcaccatgtcaggcttctgtttacggtcagtttggcattacagatcatc
aatttgggaaacagctatcaaagagagaaacataacggcggtagagaggaagtcaccaag
gttgccactcagaagcaccgacagtcaccgctcaactggacctccagtcatttcggagag
gtgactgggagcgccgagggctgggggccggaggagccgctcccctactcccgggctttc
ggagagggtgcgtccgcgcggccgcgctgctgcaggaacggcggtacctgcgtgctgggc
agcttctgcgtgtgcccggcccacttcaccggccgctactgcgagcatgaccagaggcgc
agtgaatgcggcgccctggagcacggagcctggaccctccgcgcctgccacctctgcagg
tgcatcttcggggccctgcactgcctccccctccagacgcctgaccgctgtgacccgaaa
gacttcctggcctcccacgctcacgggccgagcgccgggggcgcgcccagcctgctactc
ttgctgccctgcgcactcctgcaccgcctcctgcgcccggatgcgcccgcgcaccctcgg
tccctggtcccttccgtcctccagcgggagcggcgcccctgcggaaggccgggacttggg
catcgcctttaa

DBGET integrated database retrieval system