KEGG   Homo sapiens (human): 5608Help
Entry
5608              CDS       T01001                                 

Gene name
MAP2K6, MAPKK6, MEK6, MKK6, PRKMK6, SAPKK-3, SAPKK3
Definition
(RefSeq) mitogen-activated protein kinase kinase 6
  KO
K04433  mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04015  Rap1 signaling pathway
hsa04218  Cellular senescence
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05135  Yersinia infection
hsa05145  Toxoplasmosis
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06110  MAPK signaling (viruses)
nt06121  TLR signaling (viruses and bacteria)
nt06123  TNF signaling (viruses)
nt06124  Chemokine signaling (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06167  Human cytomegalovirus (HCMV)
nt06211  Other MAPK signaling
nt06263  Hepatocellular carcinoma
  Element
N00186  IL1-IL1R-p38 signaling pathway
N00409  HCMV UL33 to GNB/G-Rho signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00444  TNF-p38 signaling pathway
N00862  Yersinia YopP/J to TLR2/4-MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    5608 (MAP2K6)
   04010 MAPK signaling pathway
    5608 (MAP2K6)
   04668 TNF signaling pathway
    5608 (MAP2K6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    5608 (MAP2K6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    5608 (MAP2K6)
   04664 Fc epsilon RI signaling pathway
    5608 (MAP2K6)
  09152 Endocrine system
   04912 GnRH signaling pathway
    5608 (MAP2K6)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5608 (MAP2K6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    5608 (MAP2K6)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    5608 (MAP2K6)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    5608 (MAP2K6)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    5608 (MAP2K6)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    5608 (MAP2K6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    5608 (MAP2K6)
   05161 Hepatitis B
    5608 (MAP2K6)
   05163 Human cytomegalovirus infection
    5608 (MAP2K6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5608 (MAP2K6)
   05169 Epstein-Barr virus infection
    5608 (MAP2K6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    5608 (MAP2K6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5608 (MAP2K6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     5608 (MAP2K6)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE7 family
   5608 (MAP2K6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Seadorna_VP7 Pkinase_fungal DUF4344 Choline_kinase APH
Motif
Other DBs
NCBI-GeneID: 5608
NCBI-ProteinID: NP_002749
OMIM: 601254
HGNC: 6846
Ensembl: ENSG00000108984
Vega: OTTHUMG00000180311
Pharos: P52564(Tchem)
UniProt: P52564 A8K3Y2
Structure
PDB: 

Position
17q24.3
AA seq 334 aa AA seqDB search
MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELG
RGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALF
REGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDV
KPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDI
WSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSK
ERPTYPELMQHPFFTLHESKGTDVASFVKLILGD
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagtcgaaaggcaagaagcgaaaccctggccttaaaattccaaaagaagcattt
gaacaacctcagaccagttccacaccacctcgagatttagactccaaggcttgcatttct
attggaaatcagaactttgaggtgaaggcagatgacctggagcctataatggaactggga
cgaggtgcgtacggggtggtggagaagatgcggcacgtgcccagcgggcagatcatggca
gtgaagcggatccgagccacagtaaatagccaggaacagaaacggctactgatggatttg
gatatttccatgaggacggtggactgtccattcactgtcaccttttatggcgcactgttt
cgggagggtgatgtgtggatctgcatggagctcatggatacatcactagataaattctac
aaacaagttattgataaaggccagacaattccagaggacatcttagggaaaatagcagtt
tctattgtaaaagcattagaacatttacatagtaagctgtctgtcattcacagagacgtc
aagccttctaatgtactcatcaatgctctcggtcaagtgaagatgtgcgattttggaatc
agtggctacttggtggactctgttgctaaaacaattgatgcaggttgcaaaccatacatg
gcccctgaaagaataaacccagagctcaaccagaagggatacagtgtgaagtctgacatt
tggagtctgggcatcacgatgattgagttggccatccttcgatttccctatgattcatgg
ggaactccatttcagcagctcaaacaggtggtagaggagccatcgccacaactcccagca
gacaagttctctgcagagtttgttgactttacctcacagtgcttaaagaagaattccaaa
gaacggcctacatacccagagctaatgcaacatccatttttcaccctacatgaatccaaa
ggaacagatgtggcatcttttgtaaaactgattcttggagactaa

DBGET integrated database retrieval system