KEGG   Homo sapiens (human): 56667
Entry
56667             CDS       T01001                                 

Gene name
MUC13, DRCC1, MUC-13
Definition
(RefSeq) mucin 13, cell surface associated
  KO
K17298  mucin-13
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    56667 (MUC13)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    56667 (MUC13)
Membrane trafficking [BR:hsa04131]
 Others
  Mucins
   Membrane bound mucins
    56667 (MUC13)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   56667 (MUC13)
SSDB
Motif
Pfam: SEA EGF_MSP1_1 DUF4064
Other DBs
NCBI-GeneID: 56667
NCBI-ProteinID: NP_149038
OMIM: 612181
HGNC: 7511
Ensembl: ENSG00000173702
Vega: OTTHUMG00000159484
Pharos: Q9H3R2(Tbio)
UniProt: Q9H3R2
Position
3q21.2
AA seq 512 aa
MKAIIHLTLLALLSVNTATNQGNSADAVTTTETATSGPTVAAADTTETNFPETASTTANT
PSFPTATSPAPPIISTHSSSTIPTPAPPIISTHSSSTIPIPTAADSESTTNVNSLATSDI
ITASSPNDGLITMVPSETQSNNEMSPTTEDNQSSGPPTGTALLETSTLNSTGPSNPCQDD
PCADNSLCVKLHNTSFCLCLEGYYYNSSTCKKGKVFPGKISVTVSETFDPEEKHSMAYQD
LHSEITSLFKDVFGTSVYGQTVILTVSTSLSPRSEMRADDKFVNVTIVTILAETTSDNEK
TVTEKINKAIRSSSSNFLNYDLTLRCDYYGCNQTADDCLNGLACDCKSDLQRPNPQSPFC
VASSLKCPDACNAQHKQCLIKKSGGAPECACVPGYQEDANGNCQKCAFGYSGLDCKDKFQ
LILTIVGTIAGIVILSMIIALIVTARSNNKTKHIEEENLIDEDFQNLKLRSTGFTNLGAE
GSVFPKVRITASRDSQMQNPYSRHSSMPRPDY
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgaaagccatcattcatcttactcttcttgctctcctttctgtaaacacagccaccaac
caaggcaactcagctgatgctgtaacaaccacagaaactgcgactagtggtcctacagta
gctgcagctgataccactgaaactaatttccctgaaactgctagcaccacagcaaataca
ccttctttcccaacagctacttcacctgctccccccataattagtacacatagttcctcc
acaattcctacacctgctccccccataattagtacacatagttcctccacaattcctata
cctactgctgcagacagtgagtcaaccacaaatgtaaattcattagctacctctgacata
atcaccgcttcatctccaaatgatggattaatcacaatggttccttctgaaacacaaagt
aacaatgaaatgtcccccaccacagaagacaatcaatcatcagggcctcccactggcacc
gctttattggagaccagcaccctaaacagcacaggtcccagcaatccttgccaagatgat
ccctgtgcagataattcgttatgtgttaagctgcataatacaagtttttgcctgtgttta
gaagggtattactacaactcttctacatgtaagaaaggaaaggtattccctgggaagatt
tcagtgacagtatcagaaacatttgacccagaagagaaacattccatggcctatcaagac
ttgcatagtgaaattactagcttgtttaaagatgtatttggcacatctgtttatggacag
actgtaattcttactgtaagcacatctctgtcaccaagatctgaaatgcgtgctgatgac
aagtttgttaatgtaacaatagtaacaattttggcagaaaccacaagtgacaatgagaag
actgtgactgagaaaattaataaagcaattagaagtagctcaagcaactttctaaactat
gatttgacccttcggtgtgattattatggctgtaaccagactgcggatgactgcctcaat
ggtttagcatgcgattgcaaatctgacctgcaaaggcctaacccacagagccctttctgc
gttgcttccagtctcaagtgtcctgatgcctgcaacgcacagcacaagcaatgcttaata
aagaagagtggtggggcccctgagtgtgcgtgcgtgcccggctaccaggaagatgctaat
gggaactgccaaaagtgtgcatttggctacagtggactcgactgtaaggacaaatttcag
ctgatcctcactattgtgggcaccatcgctggcattgtcattctcagcatgataattgca
ttgattgtcacagcaagatcaaataacaaaacgaagcatattgaagaagagaacttgatt
gacgaagactttcaaaatctaaaactgcggtcgacaggcttcaccaatcttggagcagaa
gggagcgtctttcctaaggtcaggataacggcctccagagacagccagatgcaaaatccc
tattcaagacacagcagcatgccccgccctgactattag

DBGET integrated database retrieval system