KEGG   Homo sapiens (human): 5670Help
Entry
5670              CDS       T01001                                 

Gene name
PSG2, CEA, PSBG2, PSG1
Definition
(RefSeq) pregnancy specific beta-1-glycoprotein 2
  KO
K06500  pregnancy specific beta-1-glycoprotein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    5670 (PSG2)
CD molecules [BR:hsa04090]
 Proteins
  5670 (PSG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 Ig_3 V-set I-set ig Ig_4 Ig_5 Ig_6 Adeno_E3_CR1 C2-set
Motif
Other DBs
NCBI-GeneID: 5670
NCBI-ProteinID: NP_112536
OMIM: 176391
HGNC: 9519
Ensembl: ENSG00000242221
Vega: OTTHUMG00000151547
Pharos: P11465(Tbio)
UniProt: P11465 A0A024R0M4
Position
19q13.31
AA seq 335 aa AA seqDB search
MGPLSAPPCTEHIKWKGLLVTASLLNFWNLPTTAQVTIEAQPPKVSEGKDVLLLVHNLPQ
NLTGYIWYKGQIRDLYHYITSYVVDGQIIIYGPAYSGRETAYSNASLLIQNVTREDAGSY
TLHIIKRGDGTRGVTGYFTFTLYLETPKPSISSSNLNPREAMETVILTCDPETPDTSYQW
WMNGQSLPMTHRFQLSETNRTLFLFGVTKYTAGPYECEIRNSGSASRSDPVTLNLLHGPD
LPRIHPSYTNYRSGDNLYLSCFANSNPPAQYSWTINGKFQQSGQNLFIPQITTKHSGLYV
CSVRNSATGEESSTSLTVKVSASTRIGLLPLLNPT
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggggcccctctcagcccctccctgcacagagcacatcaaatggaaggggctcctggtc
acagcatcacttttaaacttctggaacctgcccaccactgcccaagtcacgattgaagcc
cagccaccaaaagtttccgaggggaaggatgttcttctacttgtccacaatttgccccag
aatcttactggctacatctggtacaaagggcaaatcagggacctctaccattacattaca
tcatatgtagtagacggtcaaataattatatatgggcctgcatatagtggacgagaaaca
gcatattccaatgcatccctgctgatccagaatgtcacccgggaggacgcaggatcctac
accttacacatcataaagcgaggtgatgggactagaggagtaactggatatttcaccttc
accttatacctggagactcccaagccctccatctccagcagcaacttaaaccccagggag
gccatggaaactgtgatcttaacctgtgatcctgagactccggacacaagctaccagtgg
tggatgaatggtcagagcctccctatgactcataggtttcagctgtccgaaaccaacagg
accctctttctatttggtgtcacaaagtatactgcaggaccctatgaatgtgaaatacgg
aactcagggagtgccagccgcagtgacccagtcaccctgaatctcctccatggtccagac
ctccccagaattcacccttcatacaccaattaccgttcaggagataacctctacttgtct
tgcttcgcgaactctaacccaccggcacagtattcttggacaattaatgggaagtttcag
caatcaggacaaaatctgtttatcccccaaattactacaaagcatagcgggctctatgtt
tgctctgttcgtaactcagccactggcgaggaaagctccacatcgttgacagtcaaagtc
tctgcttctacaagaataggacttcttcctctccttaatccaacatag

DBGET integrated database retrieval system