KEGG   Homo sapiens (human): 56914
Entry
56914             CDS       T01001                                 

Gene name
OTOR, FDP, MIAL1
Definition
(RefSeq) otoraplin
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: SH3_2 SH3_9
Other DBs
NCBI-GeneID: 56914
NCBI-ProteinID: NP_064542
OMIM: 606067
HGNC: 8517
Ensembl: ENSG00000125879
Vega: OTTHUMG00000031931
Pharos: Q9NRC9(Tbio)
UniProt: Q9NRC9
Position
20p12.1
AA seq 128 aa
MARILLLFLPGLVAVCAVHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINV
KKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPT
TDIDFFCE
NT seq 387 nt   +upstreamnt  +downstreamnt
atggcaagaatattgttacttttcctcccgggtcttgtggctgtatgtgctgtgcatgga
atatttatggaccgtctagcttccaagaagctctgtgcagatgatgagtgtgtctatact
atttctctggctagtgctcaagaagattataatgccccggactgtagattcattaacgtt
aaaaaagggcagcagatctatgtgtactcaaagctggtaaaagaaaatggagctggagaa
ttttgggctggcagtgtttatggtgatggccaggacgagatgggagtcgtgggttatttc
cccaggaacttggtcaaggaacagcgtgtgtaccaggaagctaccaaggaagttcccacc
acggatattgacttcttctgcgagtaa

DBGET integrated database retrieval system