KEGG   Homo sapiens (human): 56940Help
Entry
56940             CDS       T01001                                 

Gene name
DUSP22, JKAP, JSP-1, JSP1, LMW-DSP2, LMWDSP2, MKP-x, MKPX, VHX
Definition
(RefSeq) dual specificity phosphatase 22
  KO
K14165  atypical dual specificity phosphatase [EC:3.1.3.16 3.1.3.48]
Organism
hsa  Homo sapiens (human)
Disease
H01601  Anaplastic large-cell lymphoma
H01892  Peripheral T cell lymphoma (PTCL)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     56940 (DUSP22)
    3.1.3.48  protein-tyrosine-phosphatase
     56940 (DUSP22)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Atypical DSPs
    56940 (DUSP22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Y_phosphatase Init_tRNA_PT PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 56940
NCBI-ProteinID: NP_064570
OMIM: 616778
HGNC: 16077
Ensembl: ENSG00000112679
Vega: OTTHUMG00000014113
Pharos: Q9NRW4(Tbio)
UniProt: Q9NRW4
Structure
PDB: 

Position
6p25.3
AA seq 184 aa AA seqDB search
MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPS
QNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRA
GRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAF
LRRL
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggggaatgggatgaacaagatcctgcccggcctgtacatcggcaacttcaaagatgcc
agagacgcggaacaattgagcaagaacaaggtgacacatattctgtctgtccacgatagt
gccaggcctatgttggagggagttaaatacctgtgcatcccagcagcggattcaccatct
caaaacctgacaagacatttcaaagaaagtattaaattcattcacgagtgccggctccgc
ggtgagagctgccttgtacactgcctggccggggtctccaggagcgtgacactggtgatc
gcatacatcatgaccgtcactgactttggctgggaggatgccctgcacaccgtgcgtgct
gggagatcctgtgccaaccccaacgtgggcttccagagacagctccaggagtttgagaag
catgaggtccatcagtatcggcagtggctgaaggaagaatatggagagagccctttgcag
gatgcagaagaagccaaaaacattctggccgctccgggaattctgaagttctgggccttt
ctcagaagactgtaa

DBGET integrated database retrieval system