KEGG   Homo sapiens (human): 57106
Entry
57106             CDS       T01001                                 
Symbol
NAT14, KLP1
Name
(RefSeq) N-acetyltransferase 14 (putative)
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 PanZ
Other DBs
NCBI-GeneID: 57106
NCBI-ProteinID: NP_065111
HGNC: 28918
Ensembl: ENSG00000090971
UniProt: Q8WUY8
Position
19:55485188..55487566
AA seq 206 aa
MAPSHLSVREMREDEKPLVLEMLKAGVKDTENRVALHALTRPPALLLLAAASSGLRFVLA
SFALALLLPVFLAVAAVKLGLRARWGSLPPPGGLGGPWVAVRGSGDVCGVLALAPGTNAG
DGARVTRLSVSRWHRRRGVGRRLLAFAEARARAWAGGMGEPRARLVVPVAVAAWGVGGML
EGCGYQAEGGWGCLGYTLVREFSKDL
NT seq 621 nt   +upstreamnt  +downstreamnt
atggcccccagccacctgtcagtgcgggagatgagggaagatgagaagcccctggtgctg
gagatgctgaaggccggcgtgaaggacacggaaaaccgcgtggccctccatgccttgaca
cggccgccggccctgctcctcctggcggcggccagcagcggcctgcgctttgtcctggct
tccttcgccctggccctcctcctgccggtgttcctggctgtggccgccgtgaagctgggc
ctgcgggcccgatggggctcgctgcctccgccgggtggcctggggggcccctgggtggcc
gtgcggggctccggtgacgtgtgtggggtcctggctctggcccctggcacaaatgcaggg
gacggggcccgggtcacccgcctgtctgtctctcgctggcaccgccgccggggcgtgggc
aggaggctgctggccttcgcggaggcccgggctcgggcctgggctgggggcatgggggag
ccccgggcccggctcgtggtccccgtggctgtggccgcctggggggtgggagggatgctg
gagggctgtggctaccaggccgaggggggctggggctgcctgggctacacgctggtgagg
gaattcagcaaagacctgtga

DBGET integrated database retrieval system