KEGG   Homo sapiens (human): 5716Help
Entry
5716              CDS       T01001                                 

Gene name
PSMD10, dJ889N15.2, p28, p28(GANK)
Definition
(RefSeq) proteasome 26S subunit, non-ATPase 10
  KO
K06694  26S proteasome non-ATPase regulatory subunit 10
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5716 (PSMD10)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     5716 (PSMD10)
  Proteasome interacting proteins (PIPs)
   Other PIPs
    5716 (PSMD10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_4 Ank_5 Ank_2 Ank Ank_3 MafB19-deam
Motif
Other DBs
NCBI-GeneID: 5716
NCBI-ProteinID: NP_002805
OMIM: 300880
HGNC: 9555
Ensembl: ENSG00000101843
Vega: OTTHUMG00000022177
Pharos: O75832(Tbio)
UniProt: O75832
Structure
PDB: 

Position
Xq22.3
AA seq 226 aa AA seqDB search
MEGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLL
QLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHE
IAVMLLEGGANPDAKDHYEATAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLAC
DEERVEEAKLLVSQGASIYIENKEEKTPLQVAKGGLGLILKRMVEG
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggaggggtgtgtgtctaacctaatggtctgcaacctggcctacagcgggaagctggaa
gagttgaaggagagtattctggccgataaatccctggctactagaactgaccaggacagc
agaactgcattgcactgggcatgctcagctggacatacagaaattgttgaatttttgttg
caacttggagtgccagtgaatgataaagacgatgcaggttggtctcctcttcatattgcg
gcttctgctggccgggatgagattgtaaaagcccttctgggaaaaggtgctcaagtgaat
gctgtcaatcaaaatggctgtactcccttacattatgcagcttcgaaaaacaggcatgag
atcgctgtcatgttactggaaggcggggctaatccagatgctaaggaccattatgaggct
acagcaatgcaccgggcagcagccaagggtaacttgaagatgattcatatccttctgtac
tacaaagcatccacaaacatccaagacactgagggtaacactcctctacacttagcctgt
gatgaggagagagtggaagaagcaaaactgctggtgtcccaaggagcaagtatttacatt
gagaataaagaagaaaagacacccctgcaagtggccaaaggtggcctgggtttaatactc
aagagaatggtggaaggttaa

DBGET integrated database retrieval system