KEGG   Homo sapiens (human): 57552Help
Entry
57552             CDS       T01001                                 

Gene name
NCEH1, AADACL1, NCEH
Definition
(RefSeq) neutral cholesterol ester hydrolase 1
  KO
K14349  neutral cholesterol ester hydrolase 1 [EC:3.1.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04927  Cortisol synthesis and secretion
hsa04934  Cushing syndrome
hsa04976  Bile secretion
hsa04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    57552 (NCEH1)
  09154 Digestive system
   04976 Bile secretion
    57552 (NCEH1)
   04979 Cholesterol metabolism
    57552 (NCEH1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    57552 (NCEH1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    57552 (NCEH1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     57552 (NCEH1)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S9: prolyl oligopeptidase family
   57552 (NCEH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_3 COesterase Peptidase_S9 Say1_Mug180 AXE1
Motif
Other DBs
NCBI-GeneID: 57552
NCBI-ProteinID: NP_065843
OMIM: 613234
HGNC: 29260
Ensembl: ENSG00000144959
Vega: OTTHUMG00000156872
Pharos: Q6PIU2(Tchem)
UniProt: Q6PIU2 A0A0R4J2G3
Position
3q26.31
AA seq 408 aa AA seqDB search
MRSSCVLLTALVALAAYYVYIPLPGSVSDPWKLMLLDATFRGAQQVSNLIHYLGLSHHLL
ALNFIIVSFGKKSAWSSAQVKVTDTDFDGVEVRVFEGPPKPEEPLKRSVVYIHGGGWALA
SAKIRYYDELCTAMAEELNAVIVSIEYRLVPKVYFPEQIHDVVRATKYFLKPEVLQKYMV
DPGRICISGDSAGGNLAAALGQQFTQDASLKNKLKLQALIYPVLQALDFNTPSYQQNVNT
PILPRYVMVKYWVDYFKGNYDFVQAMIVNNHTSLDVEEAAAVRARLNWTSLLPASFTKNY
KPVVQTTGNARIVQELPQLLDARSAPLIADQAVLQLLPKTYILTCEHDVLRDDGIMYAKR
LESAGVEVTLDHFEDGFHGCMIFTSWPTNFSVGIRTRNSYIKWLDQNL
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaggtcgtcctgtgtcctgctcaccgccctggtggcgctggccgcctattacgtctac
atcccgctgcctggctccgtgtccgacccctggaagctgatgctgctggacgccactttc
cggggtgcacagcaagtgagtaacctgatccactacctgggactgagccatcacctgctg
gcactgaattttatcattgtttcttttggcaaaaaaagcgcgtggtcttctgcccaagtg
aaggtgaccgacacagactttgatggtgtggaagtcagagtgtttgaaggccctccgaag
cccgaagagccactgaaacgcagcgtcgtttatatccacggaggaggctgggccttggca
agtgcaaaaatcaggtattatgatgagctgtgtacagcaatggctgaggaattgaatgct
gtcattgtttccattgaatacaggctagttccaaaggtttattttcctgagcaaattcat
gatgttgtacgggccacaaagtatttcctgaagccagaagtcttacagaagtatatggtt
gatccaggcagaatttgcatttctggtgacagtgctggtggaaatctggctgctgccctt
ggacaacagtttactcaagatgccagcctaaaaaataagctcaaactacaagctttaatt
tatccagttcttcaagctttagattttaacacaccatcttatcagcaaaatgtgaacacc
ccaatcctgccccgctatgtcatggtgaagtattgggtggactacttcaaaggcaactat
gactttgtgcaggcaatgatcgttaacaatcacacttcacttgatgtggaagaggctgct
gctgtcagggcccgtctaaactggacatccctcttgcctgcatccttcacaaagaactac
aagcctgttgtacagaccacaggcaatgccaggattgtccaggagcttcctcagttgctg
gatgcccgctccgccccactcattgcagaccaggcagtgctgcagctcctcccaaagacc
tacattctgacgtgtgagcatgatgtcctcagagacgatggcatcatgtatgccaagcgt
ttggagagtgccggtgtggaggtgaccctggatcactttgaggatggctttcacggatgt
atgattttcactagctggcccaccaacttctcagtgggaatccggactaggaatagttac
atcaagtggctagatcaaaacctgtaa

DBGET integrated database retrieval system