KEGG   Homo sapiens (human): 57592Help
Entry
57592             CDS       T01001                                 

Gene name
ZNF687, PDB6
Definition
(RefSeq) zinc finger protein 687
Organism
hsa  Homo sapiens (human)
Disease
H00437  Paget disease of bone
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2_4 zf-C2H2_11 zf-C2H2 zf-met zf-C2H2_jaz zf-H2C2_2
Motif
Other DBs
NCBI-GeneID: 57592
NCBI-ProteinID: NP_001291692
OMIM: 610568
HGNC: 29277
Ensembl: ENSG00000143373
Vega: OTTHUMG00000012347
Pharos: Q8N1G0(Tdark)
UniProt: Q8N1G0
Position
1q21.3
AA seq 1237 aa AA seqDB search
MGDMKTPDFDDLLAAFDIPDIDANEAIHSGPEENEGPGGPGKPEPGVGSESEDTAAASAG
DGPGVPAQASDHGLPPPDISVVSVIVKNTVCPEQSEALAGGSAGDGAQAAGVTKEGPVGP
HRMQNGFGSPEPSLPGTPHSPAPPSGGTWKEKGMEGKTPLDLFAHFGPEPGDHSDPLPPS
APSPTREGALTPPPFPSSFELAQENGPGMQPPVSSPPLGALKQESCSPHHPQVLAQQGSG
SSPKATDIPASASPPPVAGVPFFKQSPGHQSPLASPKVPVCQPLKEEDDDEGPVDKSSPG
SPQSPSSGAEAADEDSNDSPASSSSRPLKVRIKTIKTSCGNITRTVTQVPSDPDPPAPLA
EGAFLAEASLLKLSPATPTSEGPKVVSVQLGDGTRLKGTVLPVATIQNASTAMLMAASVA
RKAVVLPGGTATSPKMIAKNVLGLVPQALPKADGRAGLGTGGQKVNGASVVMVQPSKTAT
GPSTGGGTVISRTQSSLVEAFNKILNSKNLLPAYRPNLSPPAEAGLALPPTGYRCLECGD
AFSLEKSLARHYDRRSMRIEVTCNHCARRLVFFNKCSLLLHAREHKDKGLVMQCSHLVMR
PVALDQMVGQPDITPLLPVAVPPVSGPLALPALGKGEGAITSSAITTVAAEAPVLPLSTE
PPAAPATSAYTCFRCLECKEQCRDKAGMAAHFQQLGPPAPGATSNVCPTCPMMLPNRCSF
SAHQRMHKNRPPHVCPECGGNFLQANFQTHLREACLHVSRRVGYRCPSCSVVFGGVNSIK
SHIQTSHCEVFHKCPICPMAFKSGPSAHAHLYSQHPSFQTQQAKLIYKCAMCDTVFTHKP
LLSSHFDQHLLPQRVSVFKCPSCPLLFAQKRTMLEHLKNTHQSGRLEETAGKGAGGALLT
PKTEPEELAVSQGGAAPATEESSSSSEEEEVPSSPEPPRPAKRPRRELGSKGLKGGGGGP
GGWTCGLCHSWFPERDEYVAHMKKEHGKSVKKFPCRLCERSFCSAPSLRRHVRVNHEGIK
RVYPCRYCTEGKRTFSSRLILEKHVQVRHGLQLGAQSPGRGTTLARGSSARAQGPGRKRR
QSSDSCSEEPDSTTPPAKSPRGGPGSGGHGPLRYRSSSSTEQSLMMGLRVEDGAQQCLDC
GLCFASPGSLSRHRFISHKKRRGVGKASALGLGDGEEEAPPSRSDPDGGDSPLPASGGPL
TCKVCGKSCDSPLNLKTHFRTHGMAFIRARQGAVGDN
NT seq 3714 nt NT seq  +upstreamnt  +downstreamnt
atgggggatatgaagacccctgattttgatgacctccttgctgcctttgacatccctgac
attgatgcgaatgaagccatccattctgggccagaagaaaatgaggggcctggaggccca
gggaagccagaaccaggtgtaggaagtgaatctgaagacacagcagcagcctctgctggg
gatggccctggagttccagcccaggcctctgaccatggcctgccaccgccagacatttct
gtagtcagtgtcattgtcaagaacactgtgtgtcccgagcagtctgaggccctggctgga
ggctcagcaggagacggggcccaggctgctggggtaactaaagaagggcctgtggggcct
catcgaatgcagaatggttttgggagccctgaaccttccctcccaggaactccccactct
cctgctcctcccagtgggggcacctggaaagaaaaaggcatggaaggcaaaactcccttg
gacctgtttgctcattttggccctgagccaggggaccactcagatccgctgcctccctct
gcaccctctcccactcgggagggggctctgaccccgcctcctttcccctcttcctttgag
ctggcccaggagaatggcccaggcatgcagccacctgtttcttccccaccattgggggcc
ttgaagcaggagagctgcagcccccatcatccccaggtcctagcccaacaaggctcaggc
tccagccctaaggccacggacatccctgccagtgcctcgcctcccccagttgctggggtg
cccttcttcaagcagtctccagggcaccagagccctcttgcctcccccaaagtgcccgtc
tgtcagcccttgaaggaagaagatgatgatgaggggccagtggacaagtcttccccagga
agtccccagagtccctctagtggggccgaggctgcagatgaggacagcaatgactcccct
gcctccagctcctctaggcctcttaaggtgcggatcaagaccattaaaacatcctgcggg
aatatcacaaggactgtaactcaggtcccctcagatcctgatccacctgcccccttggct
gagggggccttcttggctgaggctagcctcttgaagctgtcccctgcaacacctacttct
gagggtccaaaggtggtgagcgtacagttgggtgatggtacaaggctgaaaggcactgtg
ctgcctgtggccaccatccagaacgccagtactgccatgctgatggcagccagtgtggct
cgcaaggctgtggtgctgcctggggggactgccaccagccctaagatgattgctaagaac
gtgctaggcctggtgccccaagccctgcctaaggctgacgggcgggcagggctggggact
gggggacagaaggtgaatggtgcctcggtggtgatggtgcaaccttcaaagacagctact
gggccaagtacagggggcggcacagtgatatcacggacccagtccagcctggtggaggcc
ttcaacaagatcctcaacagcaagaacctgctccctgcctataggccaaacctgagccca
ccagctgaggctgggctggccctgcctcccaccggctaccgctgcctggagtgtggggat
gccttctcattggagaagagcctggcacggcactatgaccgtcggagcatgcgcatcgag
gtcacctgcaaccactgcgcccgccgcctggtcttcttcaacaagtgcagcctgctcctg
catgcacgtgaacacaaggacaaggggctcgtcatgcagtgctcacatttggtcatgagg
cctgtagcccttgaccagatggtggggcagccggacatcacaccgctgctgcctgtagct
gtcccacctgtctctggacctctggccttgcctgccttgggcaagggtgagggggccatc
acctcctctgccattactacagttgctgctgaggcccctgtcctgccgctctccacagag
ccgcctgctgccccggccacctctgcttacacatgctttcgctgcctggagtgcaaggaa
cagtgccgggacaaggctggcatggcagctcacttccagcagctcggcccccctgcccct
ggggccaccagcaatgtgtgcccaacctgccccatgatgctccccaatcgctgcagcttc
agcgcccaccagcgcatgcataagaatcgacccccccatgtctgtcctgagtgtgggggc
aacttcctgcaagccaattttcagacccatctccgggaggcctgtctgcacgtctctcgc
cgtgtaggatacaggtgccccagctgttcagtggtgtttgggggtgtgaactccatcaag
tcccacatccagacgtcgcactgcgaggttttccacaagtgccccatctgccccatggcc
ttcaagtctgggccaagtgcccatgcccacctctactcccagcatcccagcttccaaact
cagcaggccaagctgatctacaagtgcgccatgtgcgacacagtcttcactcacaaaccc
ctcctctcctcacacttcgaccagcacttgctgccccagcgtgtcagtgtctttaagtgc
ccgtcttgtcctctgctctttgcccaaaaaaggaccatgctggaacatctcaagaacacc
catcagtctgggcgcttggaggagactgctgggaaaggggccgggggtgccctgctgacc
cccaagactgagcctgaggagctggctgtttctcagggaggggcagcccctgctactgag
gagtcgtcttcatcttcagaagaggaggaagtacccagctcccctgagcccccccgtcca
gccaaacggcctcggcgggaactagggagcaaaggcctcaagggtgggggtggggggcct
ggaggctggacctgtggcctgtgtcactcctggttccctgagcgtgatgaatacgtggcc
cacatgaagaaggagcatggcaagtcagtgaaaaagttcccctgtcgcctgtgtgagcgc
tccttctgctccgcccccagcctgaggcgccatgtcagagttaatcacgagggcatcaag
cgagtttacccctgcaggtattgcacagagggaaaacgcaccttcagcagccgcctgatc
ctagagaaacatgtccaggtccggcacggcttgcagcttggggcccagtcccctggccgg
gggaccaccttggctcggggttccagtgccagagcccaggggccaggtcggaaacgccgc
cagtcttctgactcttgcagtgaggagcctgacagcacgacaccgccagccaagtccccc
aggggcggacctggatctggaggccatggccctctgcgctaccggagcagcagctccaca
gaacagagcctcatgatggggttgagggtggaggatggtgcccagcagtgcctcgactgt
ggcttgtgctttgcctcccctggctccctgagccgacaccgtttcatcagccacaagaag
agacggggtgtgggtaaagccagtgccctggggctgggggatggggaggaagaggcccct
ccatcaaggtctgaccccgatggtggagactcacccctgcctgcttctggaggcccactg
acctgtaaggtctgtggcaagagctgcgacagccctctaaacctcaagacccacttccgc
acgcatggcatggcgttcatcagggctcggcagggggctgttggggacaactag

DBGET integrated database retrieval system