KEGG   Homo sapiens (human): 57763
Entry
57763             CDS       T01001                                 

Gene name
ANKRA2, ANKRA
Definition
(RefSeq) ankyrin repeat family A member 2
  KO
K21486  ankyrin repeat family A protein 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    57763 (ANKRA2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HDAC complexes
    Other HDAC associated proteins
     57763 (ANKRA2)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank_3 Ank Ank_4 Fer4_14
Other DBs
NCBI-GeneID: 57763
NCBI-ProteinID: NP_075526
OMIM: 605787
HGNC: 13208
Ensembl: ENSG00000164331
Vega: OTTHUMG00000102030
Pharos: Q9H9E1(Tbio)
UniProt: Q9H9E1 A0A024RAN7
Structure
PDB: 

Position
5q13.2
AA seq 313 aa
MDTSTNLDIGAQLIVEECPSTYSLTGMPDIKIEHPLDPNSEEGSAQGVAMGMKFILPNRF
DMNVCSRFVKSLNEEDSKNIQDQVNSDLEVASVLFKAECNIHTSPSPGIQVRHVYTPSTT
KHFSPIKQSTTLTNKHRGNEVSTTPLLANSLSVHQLAAQGEMLYLATRIEQENVINHTDE
EGFTPLMWAAAHGQIAVVEFLLQNGADPQLLGKGRESALSLACSKGYTDIVKMLLDCGVD
VNEYDWNGGTPLLYAVHGNHVKCVKMLLESGADPTIETDSGYNSMDLAVALGYRSVQQVI
ESHLLKLLQNIKE
NT seq 942 nt   +upstreamnt  +downstreamnt
atggatacatcaacaaatctggatattggagcccagcttatcgtggaagagtgtcccagc
acttatagcctaactggcatgccagacattaaaatagaacatccactggacccaaattca
gaagaagggtcagctcagggtgttgccatgggaatgaaattcatattgcctaaccgattt
gatatgaatgtgtgttctcgatttgtgaagtccttaaatgaagaagatagtaaaaatatt
caagatcaggttaactctgacctggaggtggcatctgtcctatttaaagctgaatgcaat
atccatacatctccttctccgggaattcaagtaaggcatgtctacaccccctctacaaca
aagcatttctcacccataaaacagtcaaccactttaaccaacaaacacagaggaaatgag
gtctctaccacacctctgttagcaaattctttgtctgttcaccagttggctgctcaggga
gagatgctctatctggctactcgtatcgaacaagaaaatgttatcaatcacacggatgaa
gaaggatttactcctctgatgtgggctgcagcacacgggcaaatagctgtggtagagttc
ctacttcagaatggtgctgatccccaacttttaggaaaaggtcgagaaagtgcactgtcg
ttggcctgtagtaaaggctacacagatattgtcaaaatgctgcttgattgtggagttgat
gtaaatgaatatgattggaatggaggaacacctctgctttatgctgtacatggaaatcat
gtgaaatgtgtaaagatgctcttagaaagtggggctgatccaacaattgaaactgactct
ggatataattctatggatctagctgtagccctaggctatagaagtgttcaacaggttatt
gagtcacatttgttgaagctgcttcaaaatatcaaggagtag

DBGET integrated database retrieval system