KEGG   Homo sapiens (human): 5788Help
Entry
5788              CDS       T01001                                 

Gene name
PTPRC, B220, CD45, CD45R, GP180, L-CA, LCA, LY5, T200
Definition
(RefSeq) protein tyrosine phosphatase, receptor type C
  KO
K06478  receptor-type tyrosine-protein phosphatase C [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04660  T cell receptor signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa05340  Primary immunodeficiency
Disease
H00091  T-B+Severe combined immunodeficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    5788 (PTPRC)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    5788 (PTPRC)
   04666 Fc gamma R-mediated phagocytosis
    5788 (PTPRC)
 09160 Human Diseases
  09163 Immune diseases
   05340 Primary immunodeficiency
    5788 (PTPRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5788 (PTPRC)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    5788 (PTPRC)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     5788 (PTPRC)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    5788 (PTPRC)
CD molecules [BR:hsa04090]
 Proteins
  5788 (PTPRC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase CD45 fn3 PTP_N PTPlike_phytase Y_phosphatase3 DSPc GnsAB_toxin SCIMP Phage_Gp23
Motif
Other DBs
NCBI-GeneID: 5788
NCBI-ProteinID: NP_002829
OMIM: 151460
HGNC: 9666
Ensembl: ENSG00000081237
Vega: OTTHUMG00000035702
Pharos: P08575(Tchem)
UniProt: P08575
Structure
PDB: 

Position
1q31.3-q32.1
AA seq 1306 aa AA seqDB search
MTMYLWLKLLAFGFAFLDTEVFVTGQSPTPSPTGLTTAKMPSVPLSSDPLPTHTTAFSPA
STFERENDFSETTTSLSPDNTSTQVSPDSLDNASAFNTTGVSSVQTPHLPTHADSQTPSA
GTDTQTFSGSAANAKLNPTPGSNAISDVPGERSTASTFPTDPVSPLTTTLSLAHHSSAAL
PARTSNTTITANTSDAYLNASETTTLSPSGSAVISTTTIATTPSKPTCDEKYANITVDYL
YNKETKLFTAKLNVNENVECGNNTCTNNEVHNLTECKNASVSISHNSCTAPDKTLILDVP
PGVEKFQLHDCTQVEKADTTICLKWKNIETFTCDTQNITYRFQCGNMIFDNKEIKLENLE
PEHEYKCDSEILYNNHKFTNASKIIKTDFGSPGEPQIIFCRSEAAHQGVITWNPPQRSFH
NFTLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTT
KSAPPSQVWNMTVSMTSDNSMHVKCRPPRDRNGPHERYHLEVEAGNTLVRNESHKNCDFR
VKDLQYSTDYTFKAYFHNGDYPGEPFILHHSTSYNSKALIAFLAFLIIVTSIALLVVLYK
IYDLHKKRSCNLDEQQELVERDDEKQLMNVEPIHADILLETYKRKIADEGRLFLAEFQSI
PRVFSKFPIKEARKPFNQNKNRYVDILPYDYNRVELSEINGDAGSNYINASYIDGFKEPR
KYIAAQGPRDETVDDFWRMIWEQKATVIVMVTRCEEGNRNKCAEYWPSMEEGTRAFGDVV
VKINQHKRCPDYIIQKLNIVNKKEKATGREVTHIQFTSWPDHGVPEDPHLLLKLRRRVNA
FSNFFSGPIVVHCSAGVGRTGTYIGIDAMLEGLEAENKVDVYGYVVKLRRQRCLMVQVEA
QYILIHQALVEYNQFGETEVNLSELHPYLHNMKKRDPPSEPSPLEAEFQRLPSYRSWRTQ
HIGNQEENKSKNRNSNVIPYDYNRVPLKHELEMSKESEHDSDESSDDDSDSEEPSKYINA
SFIMSYWKPEVMIAAQGPLKETIGDFWQMIFQRKVKVIVMLTELKHGDQEICAQYWGEGK
QTYGDIEVDLKDTDKSSTYTLRVFELRHSKRKDSRTVYQYQYTNWSVEQLPAEPKELISM
IQVVKQKLPQKNSSEGNKHHKSTPLLIHCRDGSQQTGIFCALLNLLESAETEEVVDIFQV
VKALRKARPGMVSTFEQYQFLYDVIASTYPAQNGQVKKNNHQEDKIEFDNEVDKVKQDAN
CVNPLGAPEKLPEAKEQAEGSEPTSGTEGPEHSVNGPASPALNQGS
NT seq 3921 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgtatttgtggcttaaactcttggcatttggctttgcctttctggacacagaa
gtatttgtgacagggcaaagcccaacaccttcccccactggattgactacagcaaagatg
cccagtgttccactttcaagtgaccccttacctactcacaccactgcattctcacccgca
agcacctttgaaagagaaaatgacttctcagagaccacaacttctcttagtccagacaat
acttccacccaagtatccccggactctttggataatgctagtgcttttaataccacaggt
gtttcatcagtacagacgcctcaccttcccacgcacgcagactcgcagacgccctctgct
ggaactgacacgcagacattcagcggctccgccgccaatgcaaaactcaaccctacccca
ggcagcaatgctatctcagatgtcccaggagagaggagtacagccagcacctttcctaca
gacccagtttccccattgacaaccaccctcagccttgcacaccacagctctgctgcctta
cctgcacgcacctccaacaccaccatcacagcgaacacctcagatgcctaccttaatgcc
tctgaaacaaccactctgagcccttctggaagcgctgtcatttcaaccacaacaatagct
actactccatctaagccaacatgtgatgaaaaatatgcaaacatcactgtggattactta
tataacaaggaaactaaattatttacagcaaagctaaatgttaatgagaatgtggaatgt
ggaaacaatacttgcacaaacaatgaggtgcataaccttacagaatgtaaaaatgcgtct
gtttccatatctcataattcatgtactgctcctgataagacattaatattagatgtgcca
ccaggggttgaaaagtttcagttacatgattgtacacaagttgaaaaagcagatactact
atttgtttaaaatggaaaaatattgaaacctttacttgtgatacacagaatattacctac
agatttcagtgtggtaatatgatatttgataataaagaaattaaattagaaaaccttgaa
cccgaacatgagtataagtgtgactcagaaatactctataataaccacaagtttactaac
gcaagtaaaattattaaaacagattttgggagtccaggagagcctcagattattttttgt
agaagtgaagctgcacatcaaggagtaattacctggaatccccctcaaagatcatttcat
aattttaccctctgttatataaaagagacagaaaaagattgcctcaatctggataaaaac
ctgatcaaatatgatttgcaaaatttaaaaccttatacgaaatatgttttatcattacat
gcctacatcattgcaaaagtgcaacgtaatggaagtgctgcaatgtgtcatttcacaact
aaaagtgctcctccaagccaggtctggaacatgactgtctccatgacatcagataatagt
atgcatgtcaagtgtaggcctcccagggaccgtaatggcccccatgaacgttaccatttg
gaagttgaagctggaaatactctggttagaaatgagtcgcataagaattgcgatttccgt
gtaaaagatcttcaatattcaacagactacacttttaaggcctattttcacaatggagac
tatcctggagaaccctttattttacatcattcaacatcttataattctaaggcactgata
gcatttctggcatttctgattattgtgacatcaatagccctgcttgttgttctctacaaa
atctatgatctacataagaaaagatcctgcaatttagatgaacagcaggagcttgttgaa
agggatgatgaaaaacaactgatgaatgtggagccaatccatgcagatattttgttggaa
acttataagaggaagattgctgatgaaggaagactttttctggctgaatttcagagcatc
ccgcgggtgttcagcaagtttcctataaaggaagctcgaaagccctttaaccagaataaa
aaccgttatgttgacattcttccttatgattataaccgtgttgaactctctgagataaac
ggagatgcagggtcaaactacataaatgccagctatattgatggtttcaaagaacccagg
aaatacattgctgcacaaggtcccagggatgaaactgttgatgatttctggaggatgatt
tgggaacagaaagccacagttattgtcatggtcactcgatgtgaagaaggaaacaggaac
aagtgtgcagaatactggccgtcaatggaagagggcactcgggcttttggagatgttgtt
gtaaagatcaaccagcacaaaagatgtccagattacatcattcagaaattgaacattgta
aataaaaaagaaaaagcaactggaagagaggtgactcacattcagttcaccagctggcca
gaccacggggtgcctgaggatcctcacttgctcctcaaactgagaaggagagtgaatgcc
ttcagcaatttcttcagtggtcccattgtggtgcactgcagtgctggtgttgggcgcaca
ggaacctatatcggaattgatgccatgctagaaggcctggaagccgagaacaaagtggat
gtttatggttatgttgtcaagctaaggcgacagagatgcctgatggttcaagtagaggcc
cagtacatcttgatccatcaggctttggtggaatacaatcagtttggagaaacagaagtg
aatttgtctgaattacatccatatctacataacatgaagaaaagggatccacccagtgag
ccgtctccactagaggctgaattccagagacttccttcatataggagctggaggacacag
cacattggaaatcaagaagaaaataaaagtaaaaacaggaattctaatgtcatcccatat
gactataacagagtgccacttaaacatgagctggaaatgagtaaagagagtgagcatgat
tcagatgaatcctctgatgatgacagtgattcagaggaaccaagcaaatacatcaatgca
tcttttataatgagctactggaaacctgaagtgatgattgctgctcagggaccactgaag
gagaccattggtgacttttggcagatgatcttccaaagaaaagtcaaagttattgttatg
ctgacagaactgaaacatggagaccaggaaatctgtgctcagtactggggagaaggaaag
caaacatatggagatattgaagttgacctgaaagacacagacaaatcttcaacttatacc
cttcgtgtctttgaactgagacattccaagaggaaagactctcgaactgtgtaccagtac
caatatacaaactggagtgtggagcagcttcctgcagaacccaaggaattaatctctatg
attcaggtcgtcaaacaaaaacttccccagaagaattcctctgaagggaacaagcatcac
aagagtacacctctactcattcactgcagggatggatctcagcaaacgggaatattttgt
gctttgttaaatctcttagaaagtgcggaaacagaagaggtagtggatatttttcaagtg
gtaaaagctctacgcaaagctaggccaggcatggtttccacattcgagcaatatcaattc
ctatatgacgtcattgccagcacctaccctgctcagaatggacaagtaaagaaaaacaac
catcaagaagataaaattgaatttgataatgaagtggacaaagtaaagcaggatgctaat
tgtgttaatccacttggtgccccagaaaagctccctgaagcaaaggaacaggctgaaggt
tctgaacccacgagtggcactgaggggccagaacattctgtcaatggtcctgcaagtcca
gctttaaatcaaggttcatag

DBGET integrated database retrieval system