KEGG   Homo sapiens (human): 5885Help
Entry
5885              CDS       T01001                                 

Gene name
RAD21, CDLS4, HR21, HRAD21, MCD1, NXP1, SCC1, hHR21
Definition
(RefSeq) RAD21 cohesin complex component
  KO
K06670  cohesin complex subunit SCC1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
Disease
H00631  Cornelia de Lange syndrome (CdLS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    5885 (RAD21)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Sister chromatid cohesion proteins
   Cohesin complex
    5885 (RAD21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad21_Rec8_N Rad21_Rec8 SMC_ScpA
Motif
Other DBs
NCBI-GeneID: 5885
NCBI-ProteinID: NP_006256
OMIM: 606462
HGNC: 9811
Ensembl: ENSG00000164754
Vega: OTTHUMG00000164959
Pharos: O60216(Tbio)
UniProt: O60216 A0A024R9J0
Structure
PDB: 

Position
8q24.11
AA seq 631 aa AA seqDB search
MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLL
LGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEENREAAYNAITLPEEFHDFDQP
LPDLDDIDVAQQFSLNQSRVEEITMREEVGNISILQENDFGDFGMDDREIMREGSAFEDD
DMLVSTTTSNLLLESEQSTSNLNEKINHLEYEDQYKDDNFGEGNDGGILDDKLISNNDGG
IFDDPPALSEAGVMLPEQPAHDDMDEDDNVSMGGPDSPDSVDPVEPMPTMTDQTTLVPNE
EEAFALEPIDITVKETKAKRKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKL
MMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEF
ENPEVPREDQQQQHQQRDVIDEPIIEEPSRLQESVMEASRTNIDESAMPPPPPQGVKRKA
GQIDPEPVMPPQQVEQMEIPPVELPPEEPPNICQLIPELELLPEKEKEKEKEKEDDEEEE
DEDASGGDQDQEERRWNKRTQQMLHGLQRALAKTGAESISLLELCRNTNRKQAAAKFYSF
LVLKKQQAIELTQEEPYSDIIATPGPRFHII
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgttctacgcacattttgttctcagtaaaagagggcctctggccaaaatttggctagcg
gcccattgggataagaagctaaccaaagcccatgtgttcgagtgtaatttagagagcagc
gtggagagtatcatctcaccaaaggtgaaaatggcattacggacatcaggacatctctta
ctgggagtagttcgaatctatcacaggaaagccaaataccttcttgcagactgtaatgaa
gcattcattaagataaagatggcttttcggccaggtgtggttgacctgcctgaggaaaat
cgggaagcagcttataatgccattactttacctgaagaatttcatgactttgatcagcca
ctgcctgacttagatgacatcgatgtggcccagcagttcagcttgaatcagagtagagtg
gaagagataaccatgagagaagaagttgggaacatcagtattttacaagaaaatgatttt
ggtgattttggaatggatgatcgtgagataatgagagaaggcagtgcttttgaggatgac
gacatgttagtaagcactactacttctaacctcctattagagtctgaacagagcaccagc
aatctgaatgagaaaattaaccatttagaatatgaagatcaatataaggatgataatttt
ggagaaggaaatgatggtggaatattagatgacaaacttattagtaataatgatggcggt
atctttgatgatccccctgccctctctgaggcaggggtgatgttgccagagcagcctgca
catgacgatatggatgaggatgataatgtatcaatgggtgggcctgatagtcctgattca
gtggatcccgttgaaccaatgccaaccatgactgatcaaacaacacttgttccaaatgag
gaagaagcatttgcattggagcctattgatataactgttaaagaaacaaaagccaagagg
aagaggaagctaattgttgacagtgtcaaagagttggatagcaagacaattagagcccaa
cttagtgattattcagatattgttactactttggatctggcaccgcccaccaagaaattg
atgatgtggaaagagacaggaggagtagaaaaactgttttctttacctgctcagcctttg
tggaataacagactactgaagctctttacacgctgtcttacaccgcttgtaccagaagac
cttagaaaaaggaggaaaggaggagaggcagataatttggatgaattcctcaaagaattt
gaaaatccagaggttcctagagaggaccagcaacagcagcatcagcagcgtgatgttatc
gatgagcccattattgaagagccaagccgcctccaggagtcagtgatggaggccagcaga
acaaacatagatgagtcagctatgcctccaccaccacctcagggagttaagcgaaaagct
ggacaaattgacccagagcctgtgatgcctcctcagcaggtagagcagatggaaatacca
cctgtagagcttcccccagaagaacctccaaatatctgtcagctaataccagagttagaa
cttctgccagaaaaagagaaggagaaagagaaggaaaaagaagatgatgaagaggaagag
gatgaagatgcatcagggggcgatcaagatcaggaagaaagaagatggaacaaaaggact
cagcagatgcttcatggtcttcagcgtgctcttgctaaaactggagctgaatctatcagt
ttgcttgagttatgtcgaaatacgaacagaaaacaagctgccgcaaagttctacagcttc
ttggttcttaaaaagcagcaagctattgagctgacacaggaagaaccgtacagtgacatc
atcgcaacacctggaccaaggttccatattatataa

DBGET integrated database retrieval system