KEGG   Homo sapiens (human): 6048Help
Entry
6048              CDS       T01001                                 

Gene name
RNF5, RING5, RMA1
Definition
(RefSeq) ring finger protein 5
  KO
K10666  E3 ubiquitin-protein ligase RNF5 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    6048 (RNF5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    6048 (RNF5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     6048 (RNF5)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    6048 (RNF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C3HC4_3 zf-C3HC4 zf-RING_2 zf-C3HC4_2 zf-RING_5 zf-RING_UBOX Prok-RING_4 zf-rbx1 zf-ANAPC11 zf-C3HC4_4 Baculo_IE-1 Zn_ribbon_17 zf-UDP Rtf2 IBR zf-RING_4
Motif
Other DBs
NCBI-GeneID: 6048
NCBI-ProteinID: NP_008844
OMIM: 602677
HGNC: 10068
Ensembl: ENSG00000204308
Vega: OTTHUMG00000031093
Pharos: Q99942(Tbio)
UniProt: Q99942 A0A024RCQ4
Position
6p21.32
AA seq 180 aa AA seqDB search
MAAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPE
RQECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGF
HFSFGVGAFPFGFFTTVFNAHEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagcggaggaggaggacgggggccccgaagggccaaatcgcgagcggggcggg
gcgggcgcgaccttcgaatgtaatatatgtttggagactgctcgggaagctgtggtcagt
gtgtgtggccacctgtactgttggccatgtcttcatcagtggctggagacacggccagaa
cggcaagagtgtccagtatgtaaagctgggatcagcagagagaaggttgtcccgctttat
gggcgagggagccagaagccccaggatcccagattaaaaactccaccccgcccccagggc
cagagaccagctccggagagcagagggggattccagccatttggtgataccgggggcttc
cacttctcatttggtgttggtgcttttccctttggctttttcaccaccgtcttcaatgcc
catgagcctttccgccggggtacaggtgtggatctgggacagggtcacccagcctccagc
tggcaggattccctcttcctgtttctcgccatcttcttctttttttggctgctcagtatt
tga

DBGET integrated database retrieval system