KEGG   Homo sapiens (human): 6091Help
Entry
6091              CDS       T01001                                 

Gene name
ROBO1, DUTT1, SAX3
Definition
(RefSeq) roundabout guidance receptor 1
  KO
K06753  roundabout, axon guidance receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    6091 (ROBO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    6091 (ROBO1)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  ROBO family
   6091 (ROBO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 Ig_2 ig fn3 V-set C2-set_2 Ig_5 Pur_ac_phosph_N
Motif
Other DBs
NCBI-GeneID: 6091
NCBI-ProteinID: NP_002932
OMIM: 602430
HGNC: 10249
Ensembl: ENSG00000169855
Vega: OTTHUMG00000158843
Pharos: Q9Y6N7(Tbio)
UniProt: Q9Y6N7
Structure
PDB: 

Position
3p12.3
AA seq 1651 aa AA seqDB search
MKWKHVPFLVMISLLSLSPNHLFLAQLIPDPEDVERGNDHGTPIPTSDNDDNSLGYTGSR
LRQEDFPPRIVEHPSDLIVSKGEPATLNCKAEGRPTPTIEWYKGGERVETDKDDPRSHRM
LLPSGSLFFLRIVHGRKSRPDEGVYVCVARNYLGEAVSHNASLEVAILRDDFRQNPSDVM
VAVGEPAVMECQPPRGHPEPTISWKKDGSPLDDKDERITIRGGKLMITYTRKSDAGKYVC
VGTNMVGERESEVAELTVLERPSFVKRPSNLAVTVDDSAEFKCEARGDPVPTVRWRKDDG
ELPKSRYEIRDDHTLKIRKVTAGDMGSYTCVAENMVGKAEASATLTVQEPPHFVVKPRDQ
VVALGRTVTFQCEATGNPQPAIFWRREGSQNLLFSYQPPQSSSRFSVSQTGDLTITNVQR
SDVGYYICQTLNVAGSIITKAYLEVTDVIADRPPPVIRQGPVNQTVAVDGTFVLSCVATG
SPVPTILWRKDGVLVSTQDSRIKQLENGVLQIRYAKLGDTGRYTCIASTPSGEATWSAYI
EVQEFGVPVQPPRPTDPNLIPSAPSKPEVTDVSRNTVTLSWQPNLNSGATPTSYIIEAFS
HASGSSWQTVAENVKTETSAIKGLKPNAIYLFLVRAANAYGISDPSQISDPVKTQDVLPT
SQGVDHKQVQRELGNAVLHLHNPTVLSSSSIEVHWTVDQQSQYIQGYKILYRPSGANHGE
SDWLVFEVRTPAKNSVVIPDLRKGVNYEIKARPFFNEFQGADSEIKFAKTLEEAPSAPPQ
GVTVSKNDGNGTAILVSWQPPPEDTQNGMVQEYKVWCLGNETRYHINKTVDGSTFSVVIP
FLVPGIRYSVEVAASTGAGSGVKSEPQFIQLDAHGNPVSPEDQVSLAQQISDVVKQPAFI
AGIGAACWIILMVFSIWLYRHRKKRNGLTSTYAGIRKVPSFTFTPTVTYQRGGEAVSSGG
RPGLLNISEPAAQPWLADTWPNTGNNHNDCSISCCTAGNGNSDSNLTTYSRPADCIANYN
NQLDNKQTNLMLPESTVYGDVDLSNKINEMKTFNSPNLKDGRFVNPSGQPTPYATTQLIQ
SNLSNNMNNGSGDSGEKHWKPLGQQKQEVAPVQYNIVEQNKLNKDYRANDTVPPTIPYNQ
SYDQNTGGSYNSSDRGSSTSGSQGHKKGARTPKVPKQGGMNWADLLPPPPAHPPPHSNSE
EYNISVDESYDQEMPCPVPPARMYLQQDELEEEEDERGPTPPVRGAASSPAAVSYSHQST
ATLTPSPQEELQPMLQDCPEETGHMQHQPDRRRQPVSPPPPPRPISPPHTYGYISGPLVS
DMDTDAPEEEEDEADMEVAKMQTRRLLLRGLEQTPASSVGDLESSVTGSMINGWGSASEE
DNISSGRSSVSSSDGSFFTDADFAQAVAAAAEYAGLKVARRQMQDAAGRRHFHASQCPRP
TSPVSTDSNMSAAVMQKTRPAKKLKHQPGHLRRETYTDDLPPPPVPPPAIKSPTAQSKTQ
LEVRPVVVPKLPSMDARTDRSSDRKGSSYKGREVLDGRQVVDMRTNPGDPREAQEQQNDG
KGRGNKAAKRDLPPAKTHLIQEDILPYCRPTFPTSNNPRDPSSSSSMSSRGSGSRQREQA
NVGRRNIAEMQVLGGYERGEDNNEELEETES
NT seq 4956 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggaaacatgttccttttttggtcatgatatcactcctcagcttatccccaaat
cacctgtttctggcccagcttattccagaccctgaagatgtagagagggggaacgaccac
gggacgccaatccccacctctgataacgatgacaattcgctgggctatacaggctcccgt
cttcgtcaggaagattttccacctcgcattgttgaacacccttcagacctgattgtctca
aaaggagaacctgcaactttgaactgcaaagctgaaggccgccccacacccactattgaa
tggtacaaagggggagagagagtggagacagacaaagatgaccctcgctcacaccgaatg
ttgctgccgagtggatctttatttttcttacgtatagtacatggacggaaaagtagacct
gatgaaggagtctatgtctgtgtagcaaggaattaccttggagaggctgtgagccacaat
gcatcgctggaagtagccatacttcgggatgacttcagacaaaacccttcggatgtcatg
gttgcagtaggagagcctgcagtaatggaatgccaacctccacgaggccatcctgagccc
accatttcatggaagaaagatggctctccactggatgataaagatgaaagaataactata
cgaggaggaaagctcatgatcacttacacccgtaaaagtgacgctggcaaatatgtttgt
gttggtaccaatatggttggggaacgtgagagtgaagtagccgagctgactgtcttagag
agaccatcatttgtgaagagacccagtaacttggcagtaactgtggatgacagtgcagaa
tttaaatgtgaggcccgaggtgaccctgtacctacagtacgatggaggaaagatgatgga
gagctgcccaaatccagatatgaaatccgagatgatcataccttgaaaattaggaaggtg
acagctggtgacatgggttcatacacttgtgttgcagaaaatatggtgggcaaagctgaa
gcatctgctactctgactgttcaagaacctccacattttgttgtgaaaccccgtgaccag
gttgttgctttgggacggactgtaacttttcagtgtgaagcaaccggaaatcctcaacca
gctattttctggaggagagaagggagtcagaatctacttttctcatatcaaccaccacag
tcatccagccgattttcagtctcccagactggcgacctcacaattactaatgtccagcga
tctgatgttggttattacatctgccagactttaaatgttgctggaagcatcatcacaaag
gcatatttggaagttacagatgtgattgcagatcggcctcccccagttattcgacaaggt
cctgtgaatcagactgtagccgtggatggcactttcgtcctcagctgtgtggccacaggc
agtccagtgcccaccattctgtggagaaaggatggagtcctcgtttcaacccaagactct
cgaatcaaacagttggagaatggagtactgcagatccgatatgctaagctgggtgatact
ggtcggtacacctgcattgcatcaacccccagtggtgaagcaacatggagtgcttacatt
gaagttcaagaatttggagttccagttcagcctccaagacctactgacccaaatttaatc
cctagtgccccatcaaaacctgaagtgacagatgtcagcagaaatacagtcacattatcg
tggcaaccaaatttgaattcaggagcaactccaacatcttatattatagaagccttcagc
catgcatctggtagcagctggcagaccgtagcagagaatgtgaaaacagaaacatctgcc
attaaaggactcaaacctaatgcaatttaccttttccttgtgagggcagctaatgcatat
ggaattagtgatccaagccaaatatcagatccagtgaaaacacaagatgtcctaccaaca
agtcagggggtggaccacaagcaggtccagagagagctgggaaatgctgttctgcacctc
cacaaccccaccgtcctttcttcctcttccatcgaagtgcactggacagtagatcaacag
tctcagtatatacaaggatataaaattctctatcggccatctggagccaaccacggagaa
tcagactggttagtttttgaagtgaggacgccagccaaaaacagtgtggtaatccctgat
ctcagaaagggagtcaactatgaaattaaggctcgccctttttttaatgaatttcaagga
gcagatagtgaaatcaagtttgccaaaaccctggaagaagcacccagtgccccaccccaa
ggtgtaactgtatccaagaatgatggaaacggaactgcaattctagttagttggcagcca
cctccagaagacactcaaaatggaatggtccaagagtataaggtttggtgtctgggcaat
gaaactcgataccacatcaacaaaacagtggatggttccaccttttccgtggtcattccc
tttcttgttcctggaatccgatacagtgtggaagtggcagccagcactggggctgggtct
ggggtaaagagtgagcctcagttcatccagctggatgcccatggaaaccctgtgtcacct
gaggaccaagtcagcctcgctcagcagatttcagatgtggtgaagcagccggccttcata
gcaggtattggagcagcctgttggatcatcctcatggtcttcagcatctggctttatcga
caccgcaagaagagaaacggacttactagtacctacgcgggtatcagaaaagtcccgtct
tttaccttcacaccaacagtaacttaccagagaggaggcgaagctgtcagcagtggaggg
aggcctggacttctcaacatcagtgaacctgccgcgcagccatggctggcagacacgtgg
cctaatactggcaacaaccacaatgactgctccatcagctgctgcacggcaggcaatgga
aacagcgacagcaacctcactacctacagtcgcccagctgattgtatagcaaattataac
aaccaactggataacaaacaaacaaatctgatgctccctgagtcaactgtttatggtgat
gtggaccttagtaacaaaatcaatgagatgaaaaccttcaatagcccaaatctgaaggat
gggcgttttgtcaatccatcagggcagcctactccttacgccaccactcagctcatccag
tcaaacctcagcaacaacatgaacaatggcagcggggactctggcgagaagcactggaaa
ccactgggacagcagaaacaagaagtggcaccagttcagtacaacatcgtggagcaaaac
aagctgaacaaagattatcgagcaaatgacacagttcctccaactatcccatacaaccaa
tcatacgaccagaacacaggaggatcctacaacagctcagaccggggcagtagtacatct
gggagtcaggggcacaagaaaggggcaagaacacccaaggtaccaaaacagggtggcatg
aactgggcagacctgcttcctcctcccccagcacatcctcctccacacagcaatagcgaa
gagtacaacatttctgtagatgaaagctatgaccaagaaatgccatgtcccgtgccacca
gcaaggatgtatttgcaacaagatgaattagaagaggaggaagatgaacgaggccccact
ccccctgttcggggagcagcttcttctccagctgccgtgtcctatagccatcagtccact
gccactctgactccctccccacaggaagaactccagcccatgttacaggattgtccagag
gagactggccacatgcagcaccagcccgacaggagacggcagcctgtgagtcctcctcca
ccaccacggccgatctcccctccacatacctatggctacatttcaggacccctggtctca
gatatggatacggatgcgccagaagaggaagaagacgaagccgacatggaggtagccaag
atgcaaaccagaaggcttttgttacgtgggcttgagcagacacctgcctccagtgttggg
gacctggagagctctgtcacggggtccatgatcaacggctggggctcagcctcagaggag
gacaacatttccagcggacgctccagtgttagttcttcggacggctcctttttcactgat
gctgactttgcccaggcagtcgcagcagcggcagagtatgctggtctgaaagtagcacga
cggcaaatgcaggatgctgctggccgtcgacattttcatgcgtctcagtgccctaggccc
acaagtcccgtgtctacagacagcaacatgagtgccgccgtaatgcagaaaaccagacca
gccaagaaactgaaacaccagccaggacatctgcgcagagaaacctacacagatgatctt
ccaccacctcctgtgccgccacctgctataaagtcacctactgcccaatccaagacacag
ctggaagtacgacctgtagtggtgccaaaactcccttctatggatgcaagaacagacaga
tcatcagacagaaaaggaagcagttacaaggggagagaagtgttggatggaagacaggtt
gttgacatgcgaacaaatccaggtgatcccagagaagcacaggaacagcaaaatgacggg
aaaggacgtggaaacaaggcagcaaaacgagaccttccaccagcaaagactcatctcatc
caagaggatattctaccttattgtagacctacttttccaacatcaaataatcccagagat
cccagttcctcaagctcaatgtcatcaagaggatcaggaagcagacaaagagaacaagca
aatgtaggtcgaagaaatattgcagaaatgcaggtacttggaggatatgaaagaggagaa
gataataatgaagaattagaggaaactgaaagctga

DBGET integrated database retrieval system