KEGG   Homo sapiens (human): 6258Help
Entry
6258              CDS       T01001                                 

Gene name
RXRG, NR2B3, RXRC
Definition
(RefSeq) retinoid X receptor gamma
  KO
K08526  retinoid X receptor gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04659  Th17 cell differentiation
hsa04919  Thyroid hormone signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05216  Thyroid cancer
hsa05222  Small cell lung cancer
hsa05223  Non-small cell lung cancer
hsa05226  Gastric cancer
Network
N00126  PAX8-PPARG fusion to PPARG-mediated transcription
Drug target
Acitretin: D02754
Adapalene: D01112
Alitretinoin: D02815
Bexarotene: D03106
Etretinate: D00316
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    6258 (RXRG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    6258 (RXRG)
   03320 PPAR signaling pathway
    6258 (RXRG)
   04919 Thyroid hormone signaling pathway
    6258 (RXRG)
   04928 Parathyroid hormone synthesis, secretion and action
    6258 (RXRG)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    6258 (RXRG)
   05202 Transcriptional misregulation in cancer
    6258 (RXRG)
  09162 Cancers: Specific types
   05226 Gastric cancer
    6258 (RXRG)
   05216 Thyroid cancer
    6258 (RXRG)
   05222 Small cell lung cancer
    6258 (RXRG)
   05223 Non-small cell lung cancer
    6258 (RXRG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6258 (RXRG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    6258 (RXRG)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    6258 (RXRG)
Nuclear receptors [BR:hsa03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   6258 (RXRG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Motif
Other DBs
NCBI-GeneID: 6258
NCBI-ProteinID: NP_008848
OMIM: 180247
HGNC: 10479
Ensembl: ENSG00000143171
Vega: OTTHUMG00000034626
Pharos: P48443(Tclin)
UniProt: P48443 F1D8Q7
Structure
PDB: 

Position
1q23.3
AA seq 463 aa AA seqDB search
MYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVG
TPLNALGSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLPGLPG
IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECATSGHEDMPVERIL
EAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtatggaaattattctcacttcatgaagtttcccgcaggctatggaggctcccctggc
cacactggctctacatccatgagcccatcagcagccttgtccacagggaagccaatggac
agccaccccagctacacagataccccagtgagtgccccacggactctgagtgcagtgggg
acccccctcaatgccctgggctctccatatcgagtcatcacctctgccatgggcccaccc
tcaggagcacttgcagcgcctccaggaatcaacttggttgccccacccagctctcagcta
aatgtggtcaacagtgtcagcagttcagaggacatcaagcccttaccagggcttcccggg
attggaaacatgaactacccatccaccagccccggatctctggttaaacacatctgtgcc
atctgtggagacagatcctcaggaaagcactacggggtatacagttgtgaaggctgcaaa
gggttcttcaagaggacgataaggaaggacctcatctacacgtgtcgggataataaagac
tgcctcattgacaagcgtcagcgcaaccgctgccagtactgtcgctatcagaagtgcctt
gtcatgggcatgaagagggaagctgtgcaagaagaaagacagaggagccgagagcgagct
gagagtgaggcagaatgtgctaccagtggtcatgaagacatgcctgtggagaggattcta
gaagctgaacttgctgttgaaccaaagacagaatcctatggtgacatgaatatggagaac
tcgacaaatgaccctgttaccaacatatgtcatgctgctgacaagcagcttttcaccctc
gttgaatgggccaagcgtattccccacttctctgacctcaccttggaggaccaggtcatt
ttgcttcgggcagggtggaatgaattgctgattgcctctttctcccaccgctcagtttcc
gtgcaggatggcatccttctggccacgggtttacatgtccaccggagcagtgcccacagt
gctggggtcggctccatctttgacagagtcctaactgagctggtttccaaaatgaaagac
atgcagatggacaagtcggaactgggatgcctgcgagccattgtactctttaacccagat
gccaagggcctgtccaacccctctgaggtggagactctgcgagagaaggtttatgccacc
cttgaggcctacaccaagcagaagtatccggaacagccaggcaggtttgccaagctgctg
ctgcgcctcccagctctgcgttccattggcttgaaatgcctggagcacctcttcttcttc
aagctcatcggggacacccccattgacaccttcctcatggagatgttggagaccccgctg
cagatcacctga

DBGET integrated database retrieval system