KEGG   Homo sapiens (human): 635Help
Entry
635               CDS       T01001                                 

Gene name
BHMT, BHMT1, HEL-S-61p
Definition
(RefSeq) betaine--homocysteine S-methyltransferase
  KO
K00544  betaine-homocysteine S-methyltransferase [EC:2.1.1.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00260  Glycine, serine and threonine metabolism
hsa00270  Cysteine and methionine metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    635 (BHMT)
   00270 Cysteine and methionine metabolism
    635 (BHMT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.5  betaine---homocysteine S-methyltransferase
     635 (BHMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: S-methyl_trans
Motif
Other DBs
NCBI-GeneID: 635
NCBI-ProteinID: NP_001704
OMIM: 602888
HGNC: 1047
Ensembl: ENSG00000145692
Vega: OTTHUMG00000108157
Pharos: Q93088(Tchem)
UniProt: Q93088 V9HWA4
Structure
PDB: 

Position
5q14.1
AA seq 406 aa AA seqDB search
MPPVGGKKAKKGILERLNAGEIVIGDGGFVFALEKRGYVKAGPWTPEAAVEHPEAVRQLH
REFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQEVNEAACDIARQVADEGDALVAG
GVSQTPSYLSCKSETEVKKVFLQQLEVFMKKNVDFLIAEYFEHVEEAVWAVETLIASGKP
VAATMCIGPEGDLHGVPPGECAVRLVKAGASIIGVNCHFDPTISLKTVKLMKEGLEAARL
KAHLMSQPLAYHTPDCNKQGFIDLPEFPFGLEPRVATRWDIQKYAREAYNLGVRYIGGCC
GFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTKPWVRARARKEYWENLRIASG
RPYNPSMSKPDGWGVTKGTAELMQQKEATTEQQLKELFEKQKFKSQ
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgccacccgttgggggcaaaaaggccaagaagggcatcctagaacgtttaaatgctgga
gagattgtgattggagatggagggtttgtctttgcactggagaagaggggctacgtaaag
gcaggaccctggactcctgaagctgctgtggagcacccagaagcagttcgccagcttcat
cgagagttcctcagagctggctcaaacgtcatgcagaccttcaccttctatgcgagtgaa
gacaagctggagaacaggggcaactatgtcttagagaagatatctgggcaggaagtcaat
gaagctgcttgcgacatcgcccgacaagtggctgatgaaggagatgctttggtagcagga
ggagtgagtcagacaccttcataccttagctgcaagagtgaaactgaagtcaaaaaagta
tttctgcaacagttagaggtctttatgaagaagaacgtggacttcttgattgcagagtat
tttgaacacgttgaagaagctgtgtgggcagttgaaaccttgatagcatccggtaaacct
gtggcagcaaccatgtgcattggcccagaaggagatttgcatggcgtgccccccggcgag
tgtgcagtgcgcctggtgaaagcaggagcatccatcattggtgtgaactgccactttgac
cccaccattagtttaaaaacagtgaagctcatgaaggagggcttggaggctgcccgactg
aaagctcacctgatgagccagcccttggcttaccacactcctgactgcaacaagcaggga
ttcatcgatctcccagaattcccatttggactggaacccagagttgccaccagatgggat
attcaaaaatacgccagagaggcctacaacctgggggtcaggtacattggcgggtgctgt
ggatttgagccctaccacatcagggcaattgcagaggagctggccccagaaaggggcttt
ttgccaccagcttcagaaaaacatggcagctggggaagtggtttggacatgcacaccaaa
ccctgggttagagcaagggccaggaaggaatactgggagaatcttcggatagcctcaggc
cggccatacaacccttcaatgtcaaagccagatggctggggagtgaccaaaggaacagcc
gagctgatgcagcagaaagaagccacaactgagcagcagctgaaagagctctttgaaaaa
caaaaattcaaatcacagtag

DBGET integrated database retrieval system