KEGG   Homo sapiens (human): 6387Help
Entry
6387              CDS       T01001                                 

Gene name
CXCL12, IRH, PBSF, SCYB12, SDF1, TLSF, TPAR1, SDF1A, SDF1B
Definition
(RefSeq) C-X-C motif chemokine ligand 12
  KO
K10031  C-X-C motif chemokine 12
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04360  Axon guidance
hsa04670  Leukocyte transendothelial migration
hsa04672  Intestinal immune network for IgA production
hsa04810  Regulation of actin cytoskeleton
hsa05163  Human cytomegalovirus infection
hsa05200  Pathways in cancer
hsa05323  Rheumatoid arthritis
Network
N00401  CXCR4-GNAQ-PLCB/G-calcineurin signaling pathway
N00405  CXCR4-GNA12/13-Rho signaling pathway
N00413  CXCR4-GNB/G-PLCB-PKC signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    6387 (CXCL12)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6387 (CXCL12)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    6387 (CXCL12)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    6387 (CXCL12)
   04672 Intestinal immune network for IgA production
    6387 (CXCL12)
   04062 Chemokine signaling pathway
    6387 (CXCL12)
  09158 Development
   04360 Axon guidance
    6387 (CXCL12)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    6387 (CXCL12)
  09162 Immune diseases
   05323 Rheumatoid arthritis
    6387 (CXCL12)
  09167 Infectious diseases
   05163 Human cytomegalovirus infection
    6387 (CXCL12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6387 (CXCL12)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    6387 (CXCL12)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6387 (CXCL12)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Chemokines
   6387 (CXCL12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6387
NCBI-ProteinID: NP_000600
OMIM: 600835
HGNC: 10672
Ensembl: ENSG00000107562
Vega: OTTHUMG00000018054
Pharos: P48061(Tbio)
UniProt: P48061
Structure
PDB: 

Position
10q11.21
AA seq 93 aa AA seqDB search
MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIV
ARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccaaggtcgtggtcgtgctggtcctcgtgctgaccgcgctctgcctcagcgac
gggaagcccgtcagcctgagctacagatgcccatgccgattcttcgaaagccatgttgcc
agagccaacgtcaagcatctcaaaattctcaacactccaaactgtgcccttcagattgta
gcccggctgaagaacaacaacagacaagtgtgcattgacccgaagctaaagtggattcag
gagtacctggagaaagctttaaacaagaggttcaagatgtga

DBGET integrated database retrieval system