KEGG   Homo sapiens (human): 640Help
Entry
640               CDS       T01001                                 

Gene name
BLK, MODY11
Definition
(RefSeq) BLK proto-oncogene, Src family tyrosine kinase
  KO
K08890  B lymphoid tyrosine kinase [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Disease
H00410  Maturity onset diabetes of the young (MODY)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    640 (BLK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     640 (BLK)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  SRC family
   640 (BLK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_3 Haspin_kinase SusD-like_3
Motif
Other DBs
NCBI-GeneID: 640
NCBI-ProteinID: NP_001706
OMIM: 191305
HGNC: 1057
Ensembl: ENSG00000136573
Vega: OTTHUMG00000090729
Pharos: P51451(Tchem)
UniProt: P51451 Q05D26
Position
8p23.1
AA seq 505 aa AA seqDB search
MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPPPPDEHLDEDK
HFVVALYDYTAMNDRDLQMLKGEKLQVLKGTGDWWLARSLVTGREGYVPSNFVARVESLE
MERWFFRSQGRKEAERQLLAPINKAGSFLIRESETNKGAFSLSVKDVTTQGELIKHYKIR
CLDEGGYYISPRITFPSLQALVQHYSKKGDGLCQRLTLPCVRPAPQNPWAQDEWEIPRQS
LRLVRKLGSGQFGEVWMGYYKNNMKVAIKTLKEGTMSPEAFLGEANVMKALQHERLVRLY
AVVTKEPIYIVTEYMARGCLLDFLKTDEGSRLSLPRLIDMSAQIAEGMAYIERMNSIHRD
LRAANILVSEALCCKIADFGLARIIDSEYTAQEGAKFPIKWTAPEAIHFGVFTIKADVWS
FGVLLMEVVTYGRVPYPGMSNPEVIRNLERGYRMPRPDTCPPELYRGVIAECWRSRPEER
PTFEFLQSVLEDFYTATERQYELQP
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggggctggtaagtagcaaaaagccggacaaggaaaagccgatcaaagagaaggacaag
ggccaatggagccccctgaaggtcagcgcccaagacaaggacgccccgccactgccgccc
ctggttgtcttcaaccaccttactcctccaccgcccgatgaacacctggatgaagacaag
catttcgtggtggctctgtatgactacaccgctatgaatgatcgggacctgcagatgctg
aagggggagaagctacaggtcctgaagggaactggagactggtggctggccaggtcactc
gtcacaggaagagaaggctatgtgcccagtaactttgtggcccgagtggagagcctggaa
atggaaaggtggttctttagatcacagggtcggaaggaggctgagaggcagcttcttgct
ccaatcaacaaggccggctcctttcttatcagagagagtgaaaccaacaaaggtgccttc
tccctgtctgtgaaggatgtcaccacccagggggagctgatcaagcactataagatccgc
tgcctggatgaagggggctactacatctccccccggatcaccttcccctcgctccaggcc
ctggtgcagcactattctaagaagggggatggtctatgccagaggctgaccctgccctgt
gtgcgcccggccccgcagaatccctgggcccaggatgaatgggagatcccccggcagtct
ctcaggctggtcaggaaactcgggtctggacaattcggcgaagtctggatgggttactac
aaaaacaacatgaaggtggccattaagacgctgaaggagggaaccatgtctccagaagcc
tttctgggtgaggccaacgtgatgaaggctctgcagcacgagcggctggtccgactctac
gcagtggtcaccaaggagcccatctacattgtcaccgagtacatggccagaggatgcctg
ctggatttcctgaagacagatgaagggagcagattgtcactcccaaggctgattgacatg
tcggcgcagattgctgaagggatggcatacattgagcgcatgaattccatccaccgcgac
ctgcgggcggccaacatcctggtgtctgaggccttgtgctgcaaaattgctgattttggc
ttggctcgaatcatcgacagtgaatacacggcccaagagggggccaagttccccatcaag
tggacagccccggaagccatccacttcggggtcttcaccatcaaagcagacgtgtggtcg
tttggagtcctcctgatggaagttgtcacttatgggcgggtgccatacccagggatgagc
aaccccgaggtcatccgcaacctggagcgcggctaccgcatgccgcgccccgacacctgc
ccgcccgagctgtaccgcggcgtcatcgccgagtgctggcgcagccggcccgaggagcgg
cccaccttcgagttcctgcagtcggtgctggaggacttctacacggccaccgagcggcag
tacgagctgcagccctag

DBGET integrated database retrieval system