KEGG   Homo sapiens (human): 64114Help
Entry
64114             CDS       T01001                                 

Gene name
TMBIM1, LFG3, MST100, MSTP100, PP1201, RECS1
Definition
(RefSeq) transmembrane BAX inhibitor motif containing 1
  KO
K06890  uncharacterized protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    64114 (TMBIM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bax1-I DUF2371 SafA GWT1
Motif
Other DBs
NCBI-GeneID: 64114
NCBI-ProteinID: NP_001308356
OMIM: 610364
HGNC: 23410
Ensembl: ENSG00000135926
Vega: OTTHUMG00000133105
Pharos: Q969X1(Tbio)
UniProt: Q969X1 B3KSM0 A0A024R472
Position
2q35
AA seq 311 aa AA seqDB search
MSNPSAPPPYEDRNPLYPGPPPPGGYGQPSVLPGGYPAYPGYPQPGYGHPAGYPQPMPPT
HPMPMNYGPGHGYDGEERAVSDSFGPGEWDDRKVRHTFIRKVYSIISVQLLITVAIIAIF
TFVEPVSAFVRRNVAVYYVSYAVFVVTYLILACCQGPRRRFPWNIILLTLFTFAMGFMTG
TISSMYQTKAVIIAMIITAVVSISVTIFCFQTKVDFTSCTGLFCVLGIVLLVTGIVTSIV
LYFQYVYWLHMLYAALGAICFTLFLAYDTQLVLGNRKHTISPEDYITGALQIYTDIIYIF
TFVLQLMGDRN
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaccccagcgccccaccaccatatgaagaccgcaaccccctgtacccaggccct
ccgccccctgggggctatgggcagccatctgtcctgccaggagggtatcctgcctaccct
ggctacccgcagcctggctacggtcaccctgctggctacccacagcccatgccccccacc
cacccgatgcccatgaactacggcccaggccatggctatgatggggaggagagagcggtg
agtgatagcttcgggcctggagagtgggatgaccggaaagtgcgacacacttttatccga
aaggtttactccatcatctccgtgcagctgctcatcactgtggccatcattgctatcttc
acctttgtggaacctgtcagcgcctttgtgaggagaaatgtggctgtctactacgtgtcc
tatgctgtcttcgttgtcacctacctgatccttgcctgctgccagggacccagacgccgt
ttcccatggaacatcattctgctgaccctttttacttttgccatgggcttcatgacgggc
accatttccagtatgtaccaaaccaaagccgtcatcattgcaatgatcatcactgcggtg
gtatccatttcagtcaccatcttctgctttcagaccaaggtggacttcacctcgtgcaca
ggcctcttctgtgtcctgggaattgtgctcctggtgactgggattgtcactagcattgtg
ctctacttccaatacgtttactggctccacatgctctatgctgctctgggggccatttgt
ttcaccctgttcctggcttacgacacacagctggtcctggggaaccggaagcacaccatc
agccccgaggactacatcactggcgccctgcagatttacacagacatcatctacatcttc
acctttgtgctgcagctgatgggggatcgcaattaa

DBGET integrated database retrieval system