KEGG   Homo sapiens (human): 64135Help
Entry
64135             CDS       T01001                                 

Gene name
IFIH1, AGS7, Hlcd, IDDM19, MDA-5, MDA5, RLR-2, SGMRT1
Definition
(RefSeq) interferon induced with helicase C domain 1
  KO
K12647  interferon-induced helicase C domain-containing protein 1 [EC:3.6.4.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa05161  Hepatitis B
hsa05162  Measles
hsa05164  Influenza A
hsa05168  Herpes simplex infection
Disease
H00408  Type 1 diabetes mellitus
H01571  Singleton-Merten syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    64135 (IFIH1)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05162 Measles
    64135 (IFIH1)
   05164 Influenza A
    64135 (IFIH1)
   05161 Hepatitis B
    64135 (IFIH1)
   05168 Herpes simplex infection
    64135 (IFIH1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    64135 (IFIH1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     64135 (IFIH1)
Pattern recognition receptors [BR:hsa04054]
 Cytoplasmic pattern recognition receptors
  RIG-I-like receptors
   64135 (IFIH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD_2 RIG-I_C-RD ResIII Helicase_C DEAD CARD AAA_22 DUF3638 AAA_19
Motif
Other DBs
NCBI-GeneID: 64135
NCBI-ProteinID: NP_071451
OMIM: 606951
HGNC: 18873
Ensembl: ENSG00000115267
Vega: OTTHUMG00000132055
Pharos: Q9BYX4(Tbio)
UniProt: Q9BYX4
Structure
PDB: 

Position
2q24.2
AA seq 1025 aa AA seqDB search
MSNGYSTDENFRYLISCFRARVKMYIQVEPVLDYLTFLPAEVKEQIQRTVATSGNMQAVE
LLLSTLEKGVWHLGWTREFVEALRRTGSPLAARYMNPELTDLPSPSFENAHDEYLQLLNL
LQPTLVDKLLVRDVLDKCMEEELLTIEDRNRIAAAENNGNESGVRELLKRIVQKENWFSA
FLNVLRQTGNNELVQELTGSDCSESNAEIENLSQVDGPQVEEQLLSTTVQPNLEKEVWGM
ENNSSESSFADSSVVSESDTSLAEGSVSCLDESLGHNSNMGSDSGTMGSDSDEENVAARA
SPEPELQLRPYQMEVAQPALEGKNIIICLPTGSGKTRVAVYIAKDHLDKKKKASEPGKVI
VLVNKVLLVEQLFRKEFQPFLKKWYRVIGLSGDTQLKISFPEVVKSCDIIISTAQILENS
LLNLENGEDAGVQLSDFSLIIIDECHHTNKEAVYNNIMRHYLMQKLKNNRLKKENKPVIP
LPQILGLTASPGVGGATKQAKAEEHILKLCANLDAFTIKTVKENLDQLKNQIQEPCKKFA
IADATREDPFKEKLLEIMTRIQTYCQMSPMSDFGTQPYEQWAIQMEKKAAKEGNRKERVC
AEHLRKYNEALQINDTIRMIDAYTHLETFYNEEKDKKFAVIEDDSDEGGDDEYCDGDEDE
DDLKKPLKLDETDRFLMTLFFENNKMLKRLAENPEYENEKLTKLRNTIMEQYTRTEESAR
GIIFTKTRQSAYALSQWITENEKFAEVGVKAHHLIGAGHSSEFKPMTQNEQKEVISKFRT
GKINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYVLVAHSGSGV
IEHETVNDFREKMMYKAIHCVQNMKPEEYAHKILELQMQSIMEKKMKTKRNIAKHYKNNP
SLITFLCKNCSVLACSGEDIHVIEKMHHVNMTPEFKELYIVRENKALQKKCADYQINGEI
ICKCGQAWGTMMVHKGLDLPCLKIRNFVVVFKNNSTKKQYKKWVELPITFPNLDYSECCL
FSDED
NT seq 3078 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatgggtattccacagacgagaatttccgctatctcatctcgtgcttcagggcc
agggtgaaaatgtacatccaggtggagcctgtgctggactacctgacctttctgcctgca
gaggtgaaggagcagattcagaggacagtcgccacctccgggaacatgcaggcagttgaa
ctgctgctgagcaccttggagaagggagtctggcaccttggttggactcgggaattcgtg
gaggccctccggagaaccggcagccctctggccgcccgctacatgaaccctgagctcacg
gacttgccctctccatcgtttgagaacgctcatgatgaatatctccaactgctgaacctc
cttcagcccactctggtggacaagcttctagttagagacgtcttggataagtgcatggag
gaggaactgttgacaattgaagacagaaaccggattgctgctgcagaaaacaatggaaat
gaatcaggtgtaagagagctactaaaaaggattgtgcagaaagaaaactggttctctgca
tttctgaatgttcttcgtcaaacaggaaacaatgaacttgtccaagagttaacaggctct
gattgctcagaaagcaatgcagagattgagaatttatcacaagttgatggtcctcaagtg
gaagagcaacttctttcaaccacagttcagccaaatctggagaaggaggtctggggcatg
gagaataactcatcagaatcatcttttgcagattcttctgtagtttcagaatcagacaca
agtttggcagaaggaagtgtcagctgcttagatgaaagtcttggacataacagcaacatg
ggcagtgattcaggcaccatgggaagtgattcagatgaagagaatgtggcagcaagagca
tccccggagccagaactccagctcaggccttaccaaatggaagttgcccagccagccttg
gaagggaagaatatcatcatctgcctccctacagggagtggaaaaaccagagtggctgtt
tacattgccaaggatcacttagacaagaagaaaaaagcatctgagcctggaaaagttata
gttcttgtcaataaggtactgctagttgaacagctcttccgcaaggagttccaaccattt
ttgaagaaatggtatcgtgttattggattaagtggtgatacccaactgaaaatatcattt
ccagaagttgtcaagtcctgtgatattattatcagtacagctcaaatccttgaaaactcc
ctcttaaacttggaaaatggagaagatgctggtgttcaattgtcagacttttccctcatt
atcattgatgaatgtcatcacaccaacaaagaagcagtgtataataacatcatgaggcat
tatttgatgcagaagttgaaaaacaatagactcaagaaagaaaacaaaccagtgattccc
cttcctcagatactgggactaacagcttcacctggtgttggaggggccacgaagcaagcc
aaagctgaagaacacattttaaaactatgtgccaatcttgatgcatttactattaaaact
gttaaagaaaaccttgatcaactgaaaaaccaaatacaggagccatgcaagaagtttgcc
attgcagatgcaaccagagaagatccatttaaagagaaacttctagaaataatgacaagg
attcaaacttattgtcaaatgagtccaatgtcagattttggaactcaaccctatgaacaa
tgggccattcaaatggaaaaaaaagctgcaaaagaaggaaatcgcaaagaacgtgtttgt
gcagaacatttgaggaagtacaatgaggccctacaaattaatgacacaattcgaatgata
gatgcgtatactcatcttgaaactttctataatgaagagaaagataagaagtttgcagtc
atagaagatgatagtgatgagggtggtgatgatgagtattgtgatggtgatgaagatgag
gatgatttaaagaaacctttgaaactggatgaaacagatagatttctcatgactttattt
tttgaaaacaataaaatgttgaaaaggctggctgaaaacccagaatatgaaaatgaaaag
ctgaccaaattaagaaataccataatggagcaatatactaggactgaggaatcagcacga
ggaataatctttacaaaaacacgacagagtgcatatgcgctttcccagtggattactgaa
aatgaaaaatttgctgaagtaggagtcaaagcccaccatctgattggagctggacacagc
agtgagttcaaacccatgacacagaatgaacaaaaagaagtcattagtaaatttcgcact
ggaaaaataaatctgcttatcgctaccacagtggcagaagaaggtctggatattaaagaa
tgtaacattgttatccgttatggtctcgtcaccaatgaaatagccatggtccaggcccgt
ggtcgagccagagctgatgagagcacctacgtcctggttgctcacagtggttcaggagtt
atcgaacatgagacagttaatgatttccgagagaagatgatgtataaagctatacattgt
gttcaaaatatgaaaccagaggagtatgctcataagattttggaattacagatgcaaagt
ataatggaaaagaaaatgaaaaccaagagaaatattgccaagcattacaagaataaccca
tcactaataactttcctttgcaaaaactgcagtgtgctagcctgttctggggaagatatc
catgtaattgagaaaatgcatcacgtcaatatgaccccagaattcaaggaactttacatt
gtaagagaaaacaaagcactgcaaaagaagtgtgccgactatcaaataaatggtgaaatc
atctgcaaatgtggccaggcttggggaacaatgatggtgcacaaaggcttagatttgcct
tgtctcaaaataaggaattttgtagtggttttcaaaaataattcaacaaagaaacaatac
aaaaagtgggtagaattacctatcacatttcccaatcttgactattcagaatgctgttta
tttagtgatgaggattag

DBGET integrated database retrieval system