KEGG   Homo sapiens (human): 64326Help
Entry
64326             CDS       T01001                                 

Gene name
COP1, RFWD2, RNF200
Definition
(RefSeq) COP1, E3 ubiquitin ligase
  KO
K10143  E3 ubiquitin-protein ligase RFWD2 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04115  p53 signaling pathway
hsa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    64326 (COP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    64326 (COP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    64326 (COP1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     64326 (COP1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    64326 (COP1)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     64326 (COP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_UBOX zf-RING_2 zf-RING_5 zf-C3HC4_4 WD40_like zf-rbx1 zf_C2H2_10 zf-RING_4 Prok-RING_4 zf-RING_10 DZR
Motif
Other DBs
NCBI-GeneID: 64326
NCBI-ProteinID: NP_071902
OMIM: 608067
HGNC: 17440
Ensembl: ENSG00000143207
Vega: OTTHUMG00000034986
Pharos: Q8NHY2(Tbio)
UniProt: Q8NHY2
Structure
PDB: 

Position
1q25.1-q25.2
AA seq 731 aa AA seqDB search
MSGSRQAGSGSAGTSPGSSAASSVTSASSSLSSSPSPPSVAVSAAALVSGGVAQAAGSGG
LGGPVRPVLVAPAVSGSGGGAVSTGLSRHSCAARPSAGVGGSSSSLGSGSRKRPLLAPLC
NGLINSYEDKSNDFVCPICFDMIEEAYMTKCGHSFCYKCIHQSLEDNNRCPKCNYVVDNI
DHLYPNFLVNELILKQKQRFEEKRFKLDHSVSSTNGHRWQIFQDWLGTDQDNLDLANVNL
MLELLVQKKKQLEAESHAAQLQILMEFLKVARRNKREQLEQIQKELSVLEEDIKRVEEMS
GLYSPVSEDSTVPQFEAPSPSHSSIIDSTEYSQPPGFSGSSQTKKQPWYNSTLASRRKRL
TAHFEDLEQCYFSTRMSRISDDSRTASQLDEFQECLSKFTRYNSVRPLATLSYASDLYNG
SSIVSSIEFDRDCDYFAIAGVTKKIKVYEYDTVIQDAVDIHYPENEMTCNSKISCISWSS
YHKNLLASSDYEGTVILWDGFTGQRSKVYQEHEKRCWSVDFNLMDPKLLASGSDDAKVKL
WSTNLDNSVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRK
AVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSE
NNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAAN
SQGTIKVLELV
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtagccgccaggccgggtcgggctccgctgggacaagccccgggtcctcggcg
gcctcctcggtgacttccgcctcctcgtctttatcctcttccccgtcgccgccttccgtg
gcggtttcggcggcagcgctggtgtccggcggggtggcccaggccgccggctcgggcggc
ctcgggggcccggtgcggcctgtgttggtggcgcccgccgtatcgggtagcggcggcggg
gcggtgtccacgggcctgtcccggcacagctgcgcggccaggcccagcgccggcgtagga
ggcagcagctccagcctaggcagcggcagcaggaagcgacctctcctcgcccccctctgc
aacgggctcatcaactcctacgaggacaaaagcaacgacttcgtatgccccatctgcttt
gatatgattgaagaagcatacatgacaaaatgtggccacagcttttgctacaagtgtatt
catcagagtttggaggacaataatagatgtcccaagtgtaactatgttgtggacaatatt
gaccatctgtatcctaatttcttggtgaatgaactcattcttaaacagaagcaaagattt
gaggaaaagaggttcaaattggaccactcagtgagtagcaccaatggccacaggtggcag
atatttcaagattggttgggaactgaccaagataaccttgatttggccaatgtcaatctt
atgttggagttactagtgcagaagaagaaacaactggaagcagaatcacatgcagcccaa
ctacagattcttatggaattcctcaaggttgcaagaagaaataagagagagcaactggaa
cagatccagaaggagctaagtgttttggaagaggatattaagagagtggaagaaatgagt
ggcttatactctcctgtcagtgaggatagcacagtgcctcaatttgaagctccttctcca
tcacacagtagtattattgattccacagaatacagccaacctccaggtttcagtggcagt
tctcagacaaagaaacagccttggtataatagcacgttagcatcaagacgaaaacgactt
actgctcattttgaagacttggagcagtgttacttttctacaaggatgtctcgtatctca
gatgacagtcgaactgcaagccagttggatgaatttcaggaatgcttgtccaagtttact
cgatataattcagtacgacctttagccacattgtcatatgctagtgatctctataatggt
tccagtatagtctctagtattgaatttgaccgggattgtgactattttgcgattgctgga
gttacaaagaagattaaagtctatgaatatgacactgtcatccaggatgcagtggatatt
cattaccctgagaatgaaatgacctgcaattcgaaaatcagctgtatcagttggagtagt
taccataagaacctgttagctagcagtgattatgaaggcactgttattttatgggatgga
ttcacaggacagaggtcaaaggtctatcaggagcatgagaagaggtgttggagtgttgac
tttaatttgatggatcctaaactcttggcttcaggttctgatgatgcaaaagtgaagctg
tggtctaccaatctagacaactcagtggcaagcattgaggcaaaggctaatgtgtgctgt
gttaaattcagcccctcttccagataccatttggctttcggctgtgcagatcactgtgtc
cactactatgatcttcgtaacactaaacagccaatcatggtattcaaaggacaccgtaaa
gcagtctcttatgcaaagtttgtgagtggtgaggaaattgtctctgcctcaacagacagt
cagctaaaactgtggaatgtagggaaaccatactgcctacgttccttcaagggtcatatc
aatgaaaaaaactttgtaggcctggcttccaatggagattatatagcttgtggaagtgaa
aataactctctctacctgtactataaaggactttctaagactttgctaacttttaagttt
gatacagtcaaaagtgttctcgacaaagaccgaaaagaagatgatacaaatgaatttgtt
agtgctgtgtgctggagggcactaccagatggggagtccaatgtgctgattgctgctaac
agtcagggtacaattaaggtgctagaattggtatga

DBGET integrated database retrieval system