KEGG   Homo sapiens (human): 64388
Entry
64388             CDS       T01001                                 

Gene name
GREM2, CKTSF1B2, DAND3, PRDC, STHAG9
Definition
(RefSeq) gremlin 2, DAN family BMP antagonist
  KO
K23318  gremlin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04350  TGF-beta signaling pathway
Disease
H00625  Tooth agenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    64388 (GREM2)
SSDB
Motif
Pfam: DAN Cys_knot TIR_2
Other DBs
NCBI-GeneID: 64388
NCBI-ProteinID: NP_071914
OMIM: 608832
HGNC: 17655
Ensembl: ENSG00000180875
Vega: OTTHUMG00000039909
Pharos: Q9H772(Tbio)
UniProt: Q9H772
Position
1q43
AA seq 168 aa
MFWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKDGSSNNSERWQHQIKEVLASSQEAL
VVTERKYLKSDWCKTQPLRQTVSEEGCRSRTILNRFCYGQCNSFYIPRHVKKEEESFQSC
AFCKPQRVTSVLVELECPGLDPPFRLKKIQKVKQCRCMSVNLSDSDKQ
NT seq 507 nt   +upstreamnt  +downstreamnt
atgttctggaagctttccctgtccttgttcctggtggcggtgctggtgaaggtggcggaa
gcccggaagaaccggccggcgggcgccatcccctcgccttacaaggacggcagcagcaac
aactcggagagatggcagcaccagatcaaggaggtgctggcctccagccaggaggccctg
gtggtcaccgagcgcaagtacctcaagagtgactggtgcaagacgcagccgctgcggcag
acggtgagcgaggagggctgccggagccgcaccatcctcaaccgcttctgctacggccag
tgcaactccttctacatcccgcggcacgtgaagaaggaggaggagtccttccagtcctgc
gccttctgcaagccccagcgcgtcacctccgtcctcgtggagctcgagtgccccggcctg
gacccacccttccgactcaagaaaatccagaaggtgaagcagtgccggtgcatgtccgtg
aacctgagcgactcggacaagcagtga

DBGET integrated database retrieval system