KEGG   Homo sapiens (human): 6594Help
Entry
6594              CDS       T01001                                 

Gene name
SMARCA1, ISWI, NURF140, SNF2L, SNF2L1, SNF2LB, SNF2LT, SWI, SWI2, hSNF2L
Definition
(RefSeq) SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1
  KO
K11727  SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 1 [EC:3.6.4.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    6594 (SMARCA1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     6594 (SMARCA1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Chromatin remodeling factors
   NuRF complex
    6594 (SMARCA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNF2_N SLIDE HAND Helicase_C ResIII DEAD Myb_DNA-binding HDA2-3 DBINO UBA_2
Motif
Other DBs
NCBI-GeneID: 6594
NCBI-ProteinID: NP_003060
OMIM: 300012
HGNC: 11097
Ensembl: ENSG00000102038
Vega: OTTHUMG00000022370
Pharos: P28370(Tbio)
UniProt: P28370
Position
Xq25-q26.1
AA seq 1054 aa AA seqDB search
MEQDTAAVAATVAAADATATIVVIEDEQPGPSTSQEEGAAAAATEATAATEKGEKKKEKN
VSSFQLKLAAKAPKSEKEMDPEYEEKMKADRAKRFEFLLKQTELFAHFIQPSAQKSPTSP
LNMKLGRPRIKKDEKQSLISAGDYRHRRTEQEEDEELLSESRKTSNVCIRFEVSPSYVKG
GPLRDYQIRGLNWLISLYENGVNGILADEMGLGKTLQTIALLGYLKHYRNIPGPHMVLVP
KSTLHNWMNEFKRWVPSLRVICFVGDKDARAAFIRDEMMPGEWDVCVTSYEMVIKEKSVF
KKFHWRYLVIDEAHRIKNEKSKLSEIVREFKSTNRLLLTGTPLQNNLHELWALLNFLLPD
VFNSADDFDSWFDTKNCLGDQKLVERLHAVLKPFLLRRIKTDVEKSLPPKKEIKIYLGLS
KMQREWYTKILMKDIDVLNSSGKMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDEH
IVSNSGKMVVLDKLLAKLKEQGSRVLIFSQMTRLLDILEDYCMWRGYEYCRLDGQTPHEE
REDKFLEVEFLGQREAIEAFNAPNSSKFIFMLSTRAGGLGINLASADVVILYDSDWNPQV
DLQAMDRAHRIGQKKPVRVFRLITDNTVEERIVERAEIKLRLDSIVIQQGRLIDQQSNKL
AKEEMLQMIRHGATHVFASKESELTDEDITTILERGEKKTAEMNERLQKMGESSLRNFRM
DIEQSLYKFEGEDYREKQKLGMVEWIEPPKRERKANYAVDAYFREALRVSEPKIPKAPRP
PKQPNVQDFQFFPPRLFELLEKEILYYRKTIGYKVPRNPDIPNPALAQREEQKKIDGAEP
LTPEETEEKEKLLTQGFTNWTKRDFNQFIKANEKYGRDDIDNIAREVEGKSPEEVMEYSA
VFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDAKIARYKAPFHQLRIQYGTSKGK
NYTEEEDRFLICMLHKMGFDRENVYEELRQCVRNAPQFRFDWFIKSRTAMEFQRRCNTLI
SLIEKENMEIEERERAEKKKRATKTPMVKFSAFS
NT seq 3165 nt NT seq  +upstreamnt  +downstreamnt
atggagcaggacactgccgcagtggcagccaccgtggcagccgcggatgcgaccgccact
atcgtggtcatagaggacgagcagcccgggccgtccacctctcaggaggagggagcggcc
gccgcggccaccgaagccaccgcggccacggagaagggcgagaagaagaaggagaaaaac
gtttcttcatttcaactcaaacttgctgctaaagcgcctaaatctgaaaaggaaatggac
ccagaatatgaagagaaaatgaaagccgaccgagcaaagagatttgaatttttactgaag
cagacagaactttttgcacatttcattcagccttcagcacagaaatctccaacatctcca
ctgaacatgaaattgggacgtccccgaataaagaaagatgaaaagcagagcttaatttct
gctggagactaccgccataggcgcacagagcaagaagaagatgaagagctactgtctgag
agtcggaaaacatctaatgtgtgtattagatttgaggtgtcaccttcatatgtgaaaggg
gggccactgagagattatcagattcgaggactgaattggttgatctctttatatgaaaat
ggagtcaatggcattttggctgatgaaatgggccttgggaaaactttacaaacaattgct
ttgcttggttacctgaaacactaccgaaatattcctggacctcacatggttttagttcca
aagtctactttacacaactggatgaatgaatttaaacgatgggtcccatctctccgtgtc
atttgttttgtcggagacaaggatgccagagctgcttttattcgtgatgaaatgatgcca
ggagagtgggatgtttgcgttacttcttatgagatggtaattaaagaaaaatctgtattc
aaaaagtttcactggcgatacctggtcattgatgaagctcacagaataaagaatgaaaaa
tctaagctttcagagattgttcgtgagttcaagtcgactaaccgcttgctcctaactgga
acacctttgcagaataacctgcatgaactgtgggccttactcaactttttattgcctgat
gtctttaattctgcagatgactttgattcttggtttgacactaaaaattgtcttggtgat
caaaaactcgtggaaagacttcatgcagttttaaaaccatttttgttacgccgtataaaa
actgatgtagagaagagtctgccacctaaaaaggaaataaagatttacttggggctgagt
aagatgcaacgagaatggtatacaaaaatcctgatgaaagatattgatgttttaaactct
tctggcaagatggacaagatgcgactcttaaacattctgatgcagcttcgaaagtgttgt
aatcatccatatctgtttgatggtgctgaacctggtccaccttataccactgatgagcat
attgtcagcaacagtggtaaaatggtagttctggataaactattggccaaactcaaagaa
cagggttcaagggttctcattttcagccagatgactcgcttgctggatattttggaagat
tattgcatgtggcgtggttatgagtattgtcgactggatggacaaaccccgcatgaagaa
agagaggataaattcctagaagtggaatttctgggtcaaagggaagcaatagaggctttt
aatgctcctaatagtagcaaattcatctttatgctaagtaccagggctggaggtctcgga
attaacctggcaagtgctgatgtggttatactatatgattcagactggaacccacaggtt
gatctacaagctatggatcgagcacatcgtattggtcagaagaaaccagtacgtgtattc
cgtctcatcactgacaacactgttgaagagaggattgtagaaagagctgagataaaactg
agactcgattcaattgttatacaacaaggaagactcattgaccaacagtctaacaagctg
gcaaaagaggaaatgttacaaatgatacggcatggagccacccatgtttttgcttctaaa
gagagtgagttgacagatgaagacattacaactattctggaaagaggggaaaagaagact
gcagagatgaatgaacgcctgcaaaaaatgggagagtcttctctaagaaattttagaatg
gacattgaacaaagtttatacaaatttgagggagaagattatagagaaaaacagaagctt
ggcatggtggaatggattgaacctcctaaacgagaacgcaaagcaaactacgcagtggat
gcctactttagagaggctttgcgtgtcagcgagccaaagattccaaaggctccacggcct
ccaaaacagccaaatgttcaggattttcaatttttcccaccacgcttatttgagctcctg
gaaaaggaaattctttattatcggaagacaataggctataaggttccaaggaatcctgat
atcccaaatccagctctggctcaaagagaagagcaaaaaaagattgatggagctgaacct
cttacaccagaagagactgaagaaaaggaaaaacttctcacacaaggtttcacaaactgg
actaaacgagattttaaccagtttattaaagctaatgagaaatatggaagagatgacatt
gataacatagctcgagaggtagagggcaaatcccctgaggaggtcatggagtattcagct
gtattttgggaacgttgcaatgaattacaggacattgagaaaattatggctcaaattgaa
cgtggagaagcaagaattcaacgaaggatcagtatcaagaaagccctggatgccaaaatt
gcaagatacaaggctccatttcatcagttgcgcattcagtatggaaccagcaaaggaaag
aactatactgaggaagaagatagattcttgatttgtatgttacacaaaatgggctttgat
agagaaaatgtatatgaagaattaagacagtgtgtacgaaatgctccccagtttagattt
gactggtttatcaagtctaggactgccatggaattccagagacgctgtaacactctgatt
tcattgattgagaaagaaaatatggaaattgaggaaagagagagagcagaaaagaagaaa
cgggcaactaaaactccaatggtaaaattttcagcattttcctaa

DBGET integrated database retrieval system