KEGG   Homo sapiens (human): 65988Help
Entry
65988             CDS       T01001                                 

Gene name
ZNF747
Definition
(RefSeq) zinc finger protein 747
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: KRAB
Motif
Other DBs
NCBI-GeneID: 65988
NCBI-ProteinID: NP_076420
HGNC: 28350
Ensembl: ENSG00000169955
Vega: OTTHUMG00000132401
Pharos: Q9BV97(Tdark)
UniProt: Q9BV97 A0A024QZG5
Position
16p11.2
AA seq 191 aa AA seqDB search
MTDPSLGLTVPMAPPLAPLPPRDPNGAGSEWRKPGAVSFADVAVYFSREEWGCLRPAQRA
LYRDVMRETYGHLGALGESPTCLPGPCASTGPAAPLGAACGVGGPGAGQAASSQRGVCVL
LPQESEAASRRSSPGWRRRPNCGIRLPRIRRWRSVRQKRTQQIPETRKRKDKGKGREPWR
SPTLWPPGLLG
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatccgtcgctggggctgacagtccccatggcgccgcctctggccccgctccct
ccccgggacccaaacggggcgggatccgagtggagaaagcccggggccgtgagcttcgcc
gacgtggccgtgtacttctcccgggaggagtggggctgcctgcggcccgcgcagagggcc
ctgtaccgggacgtgatgcgggagacctacggccacctgggcgcgctcggtgagagcccc
acctgcttgcctgggccctgcgcctccacaggccctgccgcgcctctgggagctgcgtgt
ggagttgggggccccggggccgggcaggcggcctcctcgcagcgtggggtttgcgttctt
ctcccccaggagtcggaggcagcaagccggcgctcatctcctgggtggaggagaaggccg
aactgtgggatccggctgcccaggatccggaggtggcgaagtgtccgacagaagcggacc
cagcagattccagaaacaaggaagaggaaagacaaagggaagggacgggagccctggaga
agcccgaccctgtggccgccgggtctcctgggctga

DBGET integrated database retrieval system