KEGG   Homo sapiens (human): 670
Entry
670               CDS       T01001                                 

Gene name
BPHL, BPH-RP, MCNAA, VACVASE
Definition
(RefSeq) biphenyl hydrolase like
  KO
K18399  valacyclovir hydrolase [EC:3.1.-.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    670 (BPHL)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     670 (BPHL)
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 BAAT_C Peptidase_S9 FSH1 LIP DLH Esterase Abhydrolase_4
Other DBs
NCBI-GeneID: 670
NCBI-ProteinID: NP_004323
OMIM: 603156
HGNC: 1094
Ensembl: ENSG00000137274
Vega: OTTHUMG00000014140
Pharos: Q86WA6(Tbio)
UniProt: Q86WA6 Q49AI2
Structure
PDB: 
2OCG 2OCK 2OCI 2OCL

Position
6p25.2
AA seq 291 aa
MVAVLGGRGVLRLRLLLSALKPGIHVPRAGPAAAFGTSVTSAKVAVNGVQLHYQQTGEGD
HAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKD
AVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIR
DVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVH
GEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ
NT seq 876 nt   +upstreamnt  +downstreamnt
atggtggctgtgctgggcggccggggcgtgttgcgcctgcggctgcttctctcagcgctg
aagcccgggatccacgtcccacgggccggacccgcggccgcgttcggcacctcggtaacc
tctgccaaagtggctgtgaatggcgttcagctgcattaccagcagactggagagggagat
cacgcagtcctgctacttcctgggatgttaggaagtggagagactgattttggacctcag
ctcaagaacctcaataagaagctcttcacggtggtcgcctgggatcctcgaggctatgga
cattccaggcccccagatcgcgatttcccagcagacttttttgaaagggatgcaaaagat
gctgttgatttgatgaaggcgctgaagtttaagaaggtttctctgctggggtggagtgat
gggggcataaccgcactcattgctgctgcaaaatatccatcttacatccacaagatggtg
atctggggcgccaacgcctacgtcactgacgaagacagcatgatatatgagggcatccga
gatgtttccaaatggagtgagagaacaagaaagcctctagaagccctctatgggtatgac
tactttgccagaacctgtgaaaagtgggtggatggcataagacagtttaaacatctccca
gatggtaacatctgccggcacctgctgccccgggtccagtgccccgccttgattgtgcac
ggtgagaaggatcctctggtcccacggtttcatgccgacttcattcataagcacgtgaaa
ggctcacggctgcatttgatgccagaaggcaaacacaacctgcatttgcgttttgcagat
gaattcaacaagttagcagaagacttcctacaatga

DBGET integrated database retrieval system