KEGG   Homo sapiens (human): 6725Help
Entry
6725              CDS       T01001                                 

Gene name
SRMS, C20orf148, PTK70, SRM, dJ697K14.1
Definition
(RefSeq) src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites
  KO
K08895  tyrosine-protein kinase Srms [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    6725 (SRMS)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     6725 (SRMS)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  SRC family
   6725 (SRMS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_9 SH3_1 SH3_2 APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 6725
NCBI-ProteinID: NP_543013
OMIM: 617797
HGNC: 11298
Ensembl: ENSG00000125508
Vega: OTTHUMG00000032977
Pharos: Q9H3Y6(Tchem)
UniProt: Q9H3Y6
Position
20q13.33
AA seq 488 aa AA seqDB search
MEPFLRRRLAFLSFFWDKIWPAGGEPDHGTPGSLDPNTDPVPTLPAEPCSPFPQLFLALY
DFTARCGGELSVRRGDRLCALEEGGGYIFARRLSGQPSAGLVPITHVAKASPETLSDQPW
YFSGVSRTQAQQLLLSPPNEPGAFLIRPSESSLGGYSLSVRAQAKVCHYRVSMAADGSLY
LQKGRLFPGLEELLTYYKANWKLIQNPLLQPCMPQKAPRQDVWERPHSEFALGRKLGEGY
FGEVWEGLWLGSLPVAIKVIKSANMKLTDLAKEIQTLKGLRHERLIRLHAVCSGGEPVYI
VTELMRKGNLQAFLGTPEGRALRLPPLLGFACQVAEGMSYLEEQRVVHRDLAARNVLVDD
GLACKVADFGLARLLKDDIYSPSSSSKIPVKWTAPEAANYRVFSQKSDVWSFGVLLHEVF
TYGQCPYEGMTNHETLQQIMRGYRLPRPAACPAEVYVLMLECWRSSPEERPSFATLREKL
HAIHRCHP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggagccgttcctcaggaggcggctggccttcctgtccttcttctgggacaagatctgg
ccggcgggcggcgagccggaccatggcacccccgggtccctggaccccaacactgaccca
gtgcccacgctccccgccgagccttgcagccccttccctcagctcttccttgcgctctat
gacttcacggcgcggtgtggcggggagctgagtgtccgccgcggggacaggctctgtgcc
ctcgaagaggggggcggctacatcttcgcacgcaggctttcgggccagcccagcgccggg
ctcgtgcccatcacccacgtggccaaggcttctcctgagacgctctcagaccaaccctgg
tactttagcggggtcagtcggacccaggcacagcagctgctcctctccccacccaacgaa
ccaggggccttcctcatccggcccagcgagagcagcctcgggggctactcactgtcagtc
cgggcccaggccaaggtctgccactaccgggtctccatggcagctgatggcagcctctac
ctgcagaagggacggctctttcccggcctggaggagctgctcacctactacaaggccaac
tggaagctgatccagaaccccctgctgcagccctgcatgccccagaaggccccgaggcag
gacgtgtgggagcggccacactccgaattcgcccttgggaggaagctgggtgaaggctac
tttggggaggtgtgggaaggcctgtggctgggctccctgcccgtggcgatcaaggtcatc
aagtcagccaacatgaagctcactgacctcgccaaggagatccagacactgaagggcctg
cggcacgagcggctcatccggctgcacgcagtgtgctcgggcggggagcctgtgtacatc
gtcacggaactcatgcgcaaggggaacctgcaggccttcctgggcacccccgagggccgg
gccctgcgtctgccgccactcctgggctttgcctgccaggtggctgagggcatgagctac
ctggaggagcagcgcgttgtgcaccgggacttggccgcccggaacgtgctcgtggacgac
ggcctggcctgcaaggtggctgacttcggcctggcccggctgctcaaggacgacatctac
tccccgagcagcagctccaagatcccggtcaagtggacagcgcctgaggcggccaattat
cgtgtcttctcccagaagtcagacgtctggtccttcggcgtcctgctgcacgaggttttc
acctatggccagtgtccctatgaagggatgaccaaccacgagacgctgcagcagatcatg
cgagggtaccggctgccgcgcccggctgcctgcccggcggaggtctacgtgctcatgctg
gagtgctggaggagcagccccgaggaacggccctccttcgccacgctgcgggagaagctg
cacgccatccacagatgccacccctga

DBGET integrated database retrieval system