KEGG   Homo sapiens (human): 6844Help
Entry
6844              CDS       T01001                                 

Gene name
VAMP2, SYB2, VAMP-2
Definition
(RefSeq) vesicle associated membrane protein 2
  KO
K13504  vesicle-associated membrane protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04130  SNARE interactions in vesicular transport
hsa04721  Synaptic vesicle cycle
hsa04911  Insulin secretion
hsa04962  Vasopressin-regulated water reabsorption
hsa04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    6844 (VAMP2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    6844 (VAMP2)
  09154 Digestive system
   04970 Salivary secretion
    6844 (VAMP2)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    6844 (VAMP2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    6844 (VAMP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    6844 (VAMP2)
Membrane trafficking [BR:hsa04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    6844 (VAMP2)
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    6844 (VAMP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Synaptobrevin MCU Orf78 PRIMA1 LMBR1 MgtE Tweety Ferlin_C DUF2207 DUF2970 CD34_antigen
Motif
Other DBs
NCBI-GeneID: 6844
NCBI-ProteinID: NP_055047
OMIM: 185881
HGNC: 12643
Ensembl: ENSG00000220205
Vega: OTTHUMG00000150254
Pharos: P63027(Tbio)
UniProt: P63027
Structure
PDB: 

Position
17p13.1
AA seq 116 aa AA seqDB search
MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKL
SELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctaccgctgccacggccccccctgctgccccggctggggagggtggtccccct
gcaccccctccaaacctcaccagtaacaggagactgcagcagacccaggcccaggtggat
gaggtggtggacatcatgagggtgaacgtggacaaggtcctggagcgagaccagaagctg
tcggagctggacgaccgtgcagatgcactccaggcgggggcctcccagtttgaaacaagc
gcagccaagctcaagcgcaaatactggtggaaaaacctcaagatgatgatcatcttggga
gtgatttgcgccatcatcctcatcatcatcatagtttacttcagcacttaa

DBGET integrated database retrieval system