KEGG   Homo sapiens (human): 6857Help
Entry
6857              CDS       T01001                                 

Gene name
SYT1, P65, SVP65, SYT
Definition
(RefSeq) synaptotagmin 1
  KO
K15290  synaptotagmin-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    6857 (SYT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    6857 (SYT1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Synaptotagmins
    6857 (SYT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C2 CEP76-C2 Comm MAP17 Shisa EphA2_TM DUF1258 Herpes_gE RCR
Motif
Other DBs
NCBI-GeneID: 6857
NCBI-ProteinID: NP_001129277
OMIM: 185605
HGNC: 11509
Ensembl: ENSG00000067715
Vega: OTTHUMG00000134326
Pharos: P21579(Tbio)
UniProt: P21579 A0A024RBE9
Structure
PDB: 

Position
12q21.2
AA seq 422 aa AA seqDB search
MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELHKIPLPPWA
LIAIAIVAVLLVLTCCFCICKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALK
DDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDP
YVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDI
IGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNL
KKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVV
TVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAV
KK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggtgagcgagagtcaccatgaggccctggcagccccgcctgtcaccactgtcgcgact
gttctgccaagcaacgccacagagccagccagtcctggagaaggaaaggaagatgcattt
tctaagctgaaggagaagtttatgaatgagttgcataaaattccattgccaccgtgggcc
ttaattgcaatagccatagtcgcagtccttttagtcctgacctgctgcttttgtatctgt
aagaaatgtttgttcaaaaagaaaaacaagaagaagggaaaggaaaaaggagggaagaat
gccattaacatgaaagatgtaaaagacttagggaagacgatgaaagatcaggccctcaag
gatgatgatgctgaaactggattgacagatggagaagaaaaagaagaacccaaagaagag
gagaaactgggaaaacttcagtattcactggattatgatttccaaaataaccagctgctg
gtagggatcattcaggctgccgaactgcccgccttggacatggggggcacatctgatcct
tacgtgaaagtgtttctgctacctgataagaagaagaaatttgagacaaaagtccaccga
aaaacccttaatcctgtcttcaatgagcaatttactttcaaggtaccatactcggaattg
ggtggcaaaaccctagtgatggctgtatatgattttgatcgtttctctaagcatgacatc
attggagaatttaaagtccctatgaacacagtggattttggccatgtaactgaggaatgg
cgtgacctgcaaagtgctgagaaggaagagcaagagaaattgggtgatatctgcttctcc
cttcgctacgtacctactgctggtaagctgactgttgtcattctggaggcaaagaacctg
aagaagatggatgtgggtggcttatccgatccttatgtgaagattcatctgatgcagaat
ggtaagaggctgaagaagaaaaagacaacaattaaaaagaacacacttaacccctactac
aatgagtcattcagctttgaagtaccttttgaacaaatccagaaagtgcaggtggtggta
actgttttggactatgacaagattggcaagaacgatgccatcggcaaagtctttgtgggc
tacaacagcaccggcgcggagctgcgacactggtcagacatgctggccaaccccaggcga
cctattgcccagtggcacaccctgcaggtagaggaggaagttgatgccatgctggccgtc
aagaagtaa

DBGET integrated database retrieval system