KEGG   Homo sapiens (human): 688Help
Entry
688               CDS       T01001                                 

Gene name
KLF5, BTEB2, CKLF, IKLF
Definition
(RefSeq) Kruppel like factor 5
  KO
K09206  krueppel-like factor 5
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    688 (KLF5)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    688 (KLF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC zf-met
Motif
Other DBs
NCBI-GeneID: 688
NCBI-ProteinID: NP_001721
OMIM: 602903
HGNC: 6349
Ensembl: ENSG00000102554
Vega: OTTHUMG00000017074
Pharos: Q13887(Tbio)
UniProt: Q13887 Q5T6X2
Structure
PDB: 

Position
13q22.1
AA seq 457 aa AA seqDB search
MATRVLSMSARLGPVPQPPAPQDEPVFAQLKPVLGAANPARDAALFPGEELKHAHHRPQA
QPAPAQAPQPAQPPATGPRLPPEDLVQTRCEMEKYLTPQLPPVPIIPEHKKYRRDSASVV
DQFFTDTEGLPYSINMNVFLPDITHLRTGLYKSQRPCVTHIKTEPVAIFSHQSETTAPPP
APTQALPEFTSIFSSHQTAAPEVNNIFIKQELPTPDLHLSVPTQQGHLYQLLNTPDLDMP
SSTNQTAAMDTLNVSMSAAMAGLNTHTSAVPQTAVKQFQGMPPCTYTMPSQFLPQQATYF
PPSPPSSEPGSPDRQAEMLQNLTPPPSYAATIASKLAIHNPNLPTTLPVNSQNIQPVRYN
RRSNPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDEL
TRHYRKHTGAKPFQCGVCNRSFSRSDHLALHMKRHQN
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggctacaagggtgctgagcatgagcgcccgcctgggacccgtgccccagccgccggcg
ccgcaggacgagccggtgttcgcgcagctcaagccggtgctgggcgccgcgaatccggcc
cgcgacgcggcgctcttccccggcgaggagctgaagcacgcgcaccaccgcccgcaggcg
cagcccgcgcccgcgcaggccccgcagccggcccagccgcccgccaccggcccgcggctg
cctccagaggacctggtccagacaagatgtgaaatggagaagtatctgacacctcagctt
cctccagttcctataattccagagcataaaaagtatagacgagacagtgcctcagtcgta
gaccagttcttcactgacactgaagggttaccttacagtatcaacatgaacgtcttcctc
cctgacatcactcacctgagaactggcctctacaaatcccagagaccgtgcgtaacacac
atcaagacagaacctgttgccattttcagccaccagagtgaaacgactgcccctcctccg
gccccgacccaggccctccctgagttcaccagtatattcagctcacaccagaccgcagct
ccagaggtgaacaatattttcatcaaacaagaacttcctacaccagatcttcatctttct
gtccctacccagcagggccacctgtaccagctactgaatacaccggatctagatatgccc
agttctacaaatcagacagcagcaatggacactcttaatgtttctatgtcagctgccatg
gcaggccttaacacacacacctctgctgttccgcagactgcagtgaaacaattccagggc
atgcccccttgcacatacacaatgccaagtcagtttcttccacaacaggccacttacttt
cccccgtcaccaccaagctcagagcctggaagtccagatagacaagcagagatgctccag
aatttaaccccacctccatcctatgctgctacaattgcttctaaactggcaattcacaat
ccaaatttacccaccaccctgccagttaactcacaaaacatccaacctgtcagatacaat
agaaggagtaaccccgatttggagaaacgacgcatccactactgcgattaccctggttgc
acaaaagtttataccaagtcttctcatttaaaagctcacctgaggactcacactggtgaa
aagccatacaagtgtacctgggaaggctgcgactggaggttcgcgcgatcggatgagctg
acccgccactaccggaagcacacaggcgccaagcccttccagtgcggggtgtgcaaccgc
agcttctcgcgctctgaccacctggccctgcatatgaagaggcaccagaactga

DBGET integrated database retrieval system