KEGG   Homo sapiens (human): 7070
Entry
7070              CDS       T01001                                 
Symbol
THY1, CD90, CDw90
Name
(RefSeq) Thy-1 cell surface antigen
  KO
K06514  Thy-1 cell surface antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    7070 (THY1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7070 (THY1)
   04090 CD molecules [BR:hsa04090]
    7070 (THY1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    7070 (THY1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   7070 (THY1)
CD molecules [BR:hsa04090]
 Proteins
  7070 (THY1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  7070 (THY1)
SSDB
Motif
Pfam: ig V-set Ig_3 I-set Ig_2 zf-C5HC2 Izumo-Ig
Other DBs
NCBI-GeneID: 7070
NCBI-ProteinID: NP_001298089
OMIM: 188230
HGNC: 11801
Ensembl: ENSG00000154096
Pharos: P04216(Tbio)
UniProt: P04216 B0YJA4
Position
11:complement(119415476..119424985)
AA seq 161 aa
MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKK
HVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNV
TVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL
NT seq 486 nt   +upstreamnt  +downstreamnt
atgaacctggccatcagcatcgctctcctgctaacagtcttgcaggtctcccgagggcag
aaggtgaccagcctaacggcctgcctagtggaccagagccttcgtctggactgccgccat
gagaataccagcagttcacccatccagtacgagttcagcctgacccgtgagacaaagaag
cacgtgctctttggcactgtgggggtgcctgagcacacataccgctcccgaaccaacttc
accagcaaatacaacatgaaggtcctctacttatccgccttcactagcaaggacgagggc
acctacacgtgtgcactccaccactctggccattccccacccatctcctcccagaacgtc
acagtgctcagagacaaactggtcaagtgtgagggcatcagcctgctggctcagaacacc
tcgtggctgctgctgctcctgctctccctctccctcctccaggccacggatttcatgtcc
ctgtga

DBGET integrated database retrieval system